KEGG   Octadecabacter antarcticus: OAN307_c23970Help
Entry
OAN307_c23970     CDS       T02538                                 

Gene name
arcA
Definition
(GenBank) arginase ArcA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
oat  Octadecabacter antarcticus
Pathway
oat00220  Arginine biosynthesis
oat00330  Arginine and proline metabolism
oat01100  Metabolic pathways
oat01110  Biosynthesis of secondary metabolites
oat01130  Biosynthesis of antibiotics
oat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    OAN307_c23970 (arcA)
   00330 Arginine and proline metabolism
    OAN307_c23970 (arcA)
Enzymes [BR:oat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     OAN307_c23970 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGI68012
UniProt: M9R723
Position
complement(2411279..2412202)
Genome map
AA seq 307 aa AA seqDB search
MTPQNILLIGAPVDSGKDRKGCIMGPDAYRTARLGDILTDLGHSVTDLGNLTPQDTDIPD
HNHLIALPQTVGWTRTLNKAAFDAAPKGLPIFLGGDHSLALGSVTGIADYAASIGKPLFV
LWLDAHSDFHTPQSTASGNLHGTPVAYLSGQDGFDDFPVVTNPVPTENICMIGLRSVDPA
EHAALARTNVEIADMRAIDEGGIRAPLAEFLAKVDAADGLLHVSLDVDFLDPDIAPAVGT
TVPGGATLREAHLVMELLHDSGRVTSLDLVELNPFMDERGKTASLMVDLTASLLGRRVFD
RPTRSFA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgcaaaacatccttctcatcggcgcgcccgtagacagcggtaaagaccgcaaa
ggctgcatcatgggaccggacgcctaccgcaccgcgcgtctgggcgacatcctgacagac
ctcggccacagcgtgaccgacctcggcaatctcacgccgcaagacaccgatatccccgac
cacaaccacctgatcgccctgccccaaactgttggctggacgcgcacactgaacaaagcc
gcctttgatgcggccccgaagggtctgccgatctttttgggtggcgatcattccctcgcg
cttgggtccgtcactggcatcgcggattacgcggccagcatcggcaagccgttgttcgtt
ctctggcttgatgcacacagcgattttcacacgccacaatcgacggccagcggcaatctg
cacggcacacccgtcgcctatctcagcggccaagacgggtttgatgactttccagttgtc
accaatccggttccgacagaaaatatctgcatgatcggtctgcgctccgttgatcccgca
gaacacgccgcccttgcccgaacaaatgttgaaatcgccgatatgcgcgccatcgatgag
ggcggcattcgcgcgccactggccgaattcctcgccaaagtagacgctgcagacggcctg
cttcatgtctcgctcgacgttgatttccttgatcccgacatcgcacccgccgtcggcaca
acagtccccggtggtgcgaccctgcgtgaggcgcatctggtgatggaactgctgcacgac
agcggccgcgtcacctcgctggatctcgtcgaactcaacccttttatggacgagcgcggc
aaaactgcctcccttatggtcgacctcaccgcgtcccttttgggccgccgcgtattcgac
cgcccaactcgttcgttcgcctaa

DBGET integrated database retrieval system