KEGG   Octadecabacter antarcticus: OAN307_c36920Help
Entry
OAN307_c36920     CDS       T02538                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase FadA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
oat  Octadecabacter antarcticus
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OAN307_c36920 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    OAN307_c36920 (fadA)
   00640 Propanoate metabolism
    OAN307_c36920 (fadA)
   00650 Butanoate metabolism
    OAN307_c36920 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    OAN307_c36920 (fadA)
   00072 Synthesis and degradation of ketone bodies
    OAN307_c36920 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OAN307_c36920 (fadA)
   00310 Lysine degradation
    OAN307_c36920 (fadA)
   00380 Tryptophan metabolism
    OAN307_c36920 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OAN307_c36920 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OAN307_c36920 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OAN307_c36920 (fadA)
Enzymes [BR:oat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OAN307_c36920 (fadA)
Exosome [BR:oat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OAN307_c36920 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3634520..3635731
Genome map
AA seq 403 aa AA seqDB search
MTDAYIYDAIRTPRGKGRKDGSLHEVTAARLSAGVLNALKDRNNLEGHAVEDVIWGNVTQ
VKEQGGCLARTAVLASNLDQSIPGLAINRFCASGMEAVNLAANQIKGGAGEAYIAGGVEM
MGRVPMGSDGAAIAVDPSIAMDTYFVPQGISADIIATEYGFSRDDADALAVESQRRAKAA
WDAGHFSKSIVPVKDQNGLTILDTDEYMRPQTDMQSLGALNAAFQAMGEVMPGFDKVALM
RYPHLERINHIHTAGNSSGIVDGAAGVLIGSKEYGIKHGLTPRARIRQTAKIGTDPTIML
TGPVPVTHKILSDAGMNIKDIDLFEVNEAFSSVVLRFMQAFNVDHSVVNVNGGSIAMGHP
LGATGAIIIGTLLDELERSDKEVGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcatatatctacgacgcgatccgcacaccgcgcggcaagggccgcaaagac
gggtccctgcacgaagtgacggccgcgcggctgtcggcaggtgttttgaacgccctgaaa
gatcgcaacaatctggaaggccacgccgttgaggatgtgatttggggcaatgtcacccaa
gtcaaagaacagggcggctgccttgcgcggactgccgtgcttgcgtccaatttggatcaa
tccattcccggtctcgcgatcaaccgtttttgtgcgtctgggatggaagcagtgaacctt
gccgcaaaccagatcaaaggtggcgcaggcgaagcctatatcgctggtggcgtagaaatg
atgggccgcgtcccgatgggcagtgacggggcggcgattgccgttgatccatccatcgca
atggacacctattttgtgcctcagggcatttcggctgacattatagccaccgaatacggg
ttctcacgcgatgatgccgacgcgctggctgttgaatcacagcgccgcgccaaagccgcg
tgggacgcaggccatttcagcaagtctattgtgcctgtgaaggatcagaacggcctgact
attctggacacagacgaatacatgcgcccgcagaccgacatgcaatctttgggcgcgctg
aatgcagctttccaagcgatgggcgaagtcatgcccggtttcgacaaggttgcactgatg
agatatccgcaccttgagcggatcaaccacatccacaccgccggcaacagttcggggatc
gtggacggcgcggcaggcgttttgatcgggtccaaagagtatggcatcaaacatggtctg
acgccgcgggcgcgtattcgccaaactgcgaaaattggcactgatccaacaatcatgctg
acgggtccggttcctgtgacgcacaaaatcctgagcgatgcgggaatgaatattaaggat
atcgatctgtttgaagtcaatgaggcgttttcaagcgtcgtgttgcggttcatgcaggcg
ttcaacgttgatcattcggtggtcaacgtgaatggcgggtctatcgccatgggccatcca
ttgggggctacgggtgcgattatcattggcaccctgctggatgagcttgagcgttctgac
aaagaggtcggcctcgccaccttgtgcatcgcatccggcatgggtgcggcgactattatt
gaacgggtgtaa

DBGET integrated database retrieval system