KEGG   Octadecabacter antarcticus: OAN307_c37060Help
Entry
OAN307_c37060     CDS       T02538                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase DeoA
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
oat  Octadecabacter antarcticus
Pathway
oat00240  Pyrimidine metabolism
oat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oat00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OAN307_c37060 (deoA)
Enzymes [BR:oat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     OAN307_c37060 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AGI69166
UniProt: M9RFF7
Position
complement(3651013..3652317)
Genome map
AA seq 434 aa AA seqDB search
MDARAIIAKVRQGEDPSHDELVWFTNGLATRMVSDAQAGAFAMAVCLNGLSDEGRVALTT
GMRDSGDVLKWDLPGPVLDKHSTGGVGDPVSLILAPALAACDVFVPMVSGRGLGHTGGTL
DKLEAIPGLNTAQNTAAFRKITRDIGCAIVSATNSIAPADKRLYAVRDVTATVESVDLIC
ASILSKKLAAGLEGLVLDVKAGSGAFMKTPAGAAKLARALTSTANGAGTPTAAFITDMSQ
PLAPCLGNGVELALCLEVLSGNRAAAPRLHDLTVALCARALALAGHAEGEAEERVKAAIS
SGHAMVCFAAMVRAMGGPPDIAEGWHTHLPSAPVIGDVPAPYAGTIAVIDGEALGLAVVQ
LGGGRQIESDRIDPRVGLTNVLPLGTKVARGDPIVTIHAADEDSAQAAAHAVLRAVTIGE
PVEITDLVLERIDP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcgcgcaatcattgccaaagtgcggcagggcgaagaccccagccacgatgaa
ttggtatggttcaccaatggtttagccacccgcatggtgtcggacgcgcaggctggcgct
ttcgcgatggcagtctgtttgaacgggcttagcgatgaaggtcgcgtggcattgaccacg
ggcatgcgcgacagtggtgatgtgttgaaatgggatttgccgggccccgtattggacaaa
cattcaacgggcggggtgggtgatccggtgtctctgattctcgcgcccgcgctggcggcg
tgcgatgtgttcgtgccgatggtgtcgggccgcggccttgggcatacgggcggcacgctc
gataaacttgaggcgatcccaggattaaacactgcgcaaaacacagccgcgttccgcaag
attacccgcgatattggctgtgcaattgtcagtgccaccaattccatcgcgcccgccgat
aaacgcttatatgccgtgcgtgacgtcaccgcgacggttgagagtgttgatttaatttgt
gcctcaattctgtccaagaaacttgcagcgggtcttgagggtctggtgcttgacgtcaaa
gcgggcagcggcgcgtttatgaaaacccccgcaggggccgcaaagctggcccgcgcgttg
acgtccacggcgaacggcgcgggcacgccgacagccgcgtttatcaccgacatgtcgcaa
ccgctggcgccatgtttgggaaatggtgtcgaattggcgctttgtcttgaggttttgtca
ggaaaccgcgctgcagcgccacgtttgcacgatctgactgtcgcactttgcgcccgcgct
ctcgcacttgcaggtcacgccgaaggcgaagccgaagaacgcgtcaaggcggccatttca
tcgggccacgcgatggtctgttttgccgcgatggtccgcgcgatgggtggcccgccagac
attgccgaaggctggcacacccatctgccatcggcccctgtcattggcgatgttcccgcg
ccttatgctgggaccattgctgtcattgacggtgaagcactgggtttggcggtggtgcaa
ttgggtggcggccgtcagatcgaaagtgatcgcattgacccgcgtgttggtctgacaaat
gtcttgccgcttgggacgaaagttgcgcgtggtgatccaatcgtgaccatccatgccgct
gatgaggacagcgcgcaagccgcagcccatgcggtcctacgcgccgtgaccattggtgaa
cctgttgaaattacagacctagttctagaacggatcgacccatga

DBGET integrated database retrieval system