KEGG   Octadecabacter antarcticus: OAN307_c48760Help
Entry
OAN307_c48760     CDS       T02538                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase MutM (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
oat  Octadecabacter antarcticus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:oat03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4808524..4809375
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLIPSMQGHVIMRADVNRPDLRWPFPDNMAARLTGAKVTALRRRSKYV
LADLDRGETLIIHLGMSGRMTVSGDPLGQFHHDHPAAAKHDHVVFHMANGARVTFNDARR
FGAMDLTQTDTLDDHWLIKPIGPEPLGNTFDETYLIKALATRNTPIKTALLDQHVVAGLG
NIYVCEVLFRARINPTRKAKDLSKKRVASLVPIIRDVLTEAIAAGGSSLKDYRQADGELG
YFQKAFQAYDREGHICQTPECTGSIARIVQSGRSTFYCPTCQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactaccagaagtcgaaaccgtgcggcgtgggctcatcccgtcgatgcaaggt
cacgtgatcatgcgcgctgacgtcaatcgccctgatttgcgctggccgttccctgacaac
atggcggcgcgtctgacgggcgcaaaagttaccgcgctgcgtcgccgttccaaatacgtc
ctcgctgatctggaccgcggcgaaactttaattatccaccttgggatgtctgggcgcatg
accgtgtctggtgatccgttgggtcaatttcaccacgaccatcccgcagctgcaaagcac
gaccatgtggtgtttcacatggcaaacggggcccgcgtgacatttaacgacgcgcggcgg
ttcggcgcgatggacctcacgcagaccgacacgttggacgatcattggctcatcaagcct
atcggccctgaaccgctggggaacacgttcgacgaaacctacctgataaaggcgctcgcg
acccgcaacacaccgatcaagacggcgctgctggatcagcacgtcgtcgctggcttgggt
aatatctacgtctgcgaagtcctgtttcgcgcccggatcaatccaacgcgaaaggcgaaa
gacctgtccaagaaacgcgtcgcgtcccttgtgccgatcattcgcgatgtcctgaccgaa
gccattgccgcagggggctcatcgctcaaggattatcgccaagcggatggcgaacttggc
tatttccaaaaggcgtttcaggcttacgaccgcgaaggtcatatctgccaaacgcccgaa
tgtaccggatcgattgcccgcattgtgcaatctggccgatcgacattctattgccctaca
tgtcaaagatag

DBGET integrated database retrieval system