KEGG   Octopus bimaculoides: 106879180Help
Entry
106879180         CDS       T04127                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
obi  Octopus bimaculoides
Brite
Enzymes [BR:obi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106879180
Peptidases [BR:obi01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   106879180
Exosome [BR:obi04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   106879180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 385 aa AA seqDB search
MGENTNEKNKNKKKSEKNNDKTDNTSKNNNKTNSNKTINKSNNKKKNTKCTKACLSGVKS
LLCFFLVIAFCTHGLLPVLFWTFPEISNFVIFSNRVKWTIFANLSDPHYFGLDHTRNFFL
QSKRNIKLGAWHILPDNLKSKAKDFSDNDYEKSLQYSETPIVMYMHGNSGSRACDHRVNL
YHRLSQMNYHIITFDYRGFGESTGIPFEDGVVEDSLFVYNWIRSRVPSDTPVILWGHSLG
TGIATRLAKTLCDGGVPPTALVLESPFNNILEASANLPPFFLYRPFRPLSYMILNSVERC
GTEFASDQNIKDVTSPILILHAEDDGLIPIKLARKLYNAGLESRPQNSGQLLLVPFDKSF
GYGHKHLHSAPNFASVVKSFLESST
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaatacgaacgagaaaaataagaacaaaaagaaaagtgaaaagaacaacgac
aaaactgacaacaccagcaaaaacaataacaaaaccaacagcaataaaaccatcaacaaa
agcaacaacaaaaagaagaatacaaaatgtaccaaggcatgtctatcaggtgttaaaagc
ctcttgtgtttcttcttggtcattgctttctgcacacatggcttgctaccagtattattc
tggacgttcccagaaatcagcaactttgtgatattctcaaaccgagtaaagtggacaatt
tttgcaaacttgagtgaccctcactattttggtttggatcataccagaaacttcttcctc
caatcaaagcggaatattaaactgggtgcttggcatatacttcctgataatttaaagagc
aaagccaaagattttagcgacaatgactatgagaaaagcctccaatattctgaaacacca
attgtgatgtatatgcatggaaactccggttccagggcctgtgatcaccgcgtcaatctg
tatcatcgtttatcacagatgaattatcatataataacttttgattatcgcggatttggt
gaatctactggtatccccttcgaagatggtgttgtagaagacagtctttttgtatacaac
tggatcagatcaagagtaccctcagacacacccgttatcttatggggacattctttagga
actggaattgctacaagattagcgaagaccttgtgtgatggtggtgtgccacccactgct
cttgtcttggagtcaccgtttaataacatcctggaagcttcagcaaacttgccaccattc
tttttatacagaccattccggccactgagttacatgattctcaactctgtcgaaagatgt
ggaacagaatttgctagtgaccaaaatatcaaagatgtaacaagtcctatattaatcctc
catgccgaagatgatggacttatacccataaaacttgccagaaagctttataacgcaggt
ttggaatcgcggccccaaaacagtggacaattgctgttagtgccattcgacaaatccttt
ggttatggacacaaacatctgcacagtgcccctaattttgcctctgtcgtcaaatcgttt
ctagagtcttccacgtaa

DBGET integrated database retrieval system