KEGG   Oryza brachyantha (malo sina): 102700381Help
Entry
102700381         CDS       T02995                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00620  Pyruvate metabolism
obr00710  Carbon fixation in photosynthetic organisms
obr01100  Metabolic pathways
obr01200  Carbon metabolism
Module
obr_M00168  CAM (Crassulacean acid metabolism), dark
obr_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
obr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
obr_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    102700381
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102700381
Enzymes [BR:obr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     102700381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 102700381
NCBI-ProteinID: XP_006644735
UniProt: J3L489
Position
1
AA seq 966 aa AA seqDB search
MARNAADKATSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YEFAAEYESKIDPKQLDAIGNVLTRLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK
LKKGDFADENSATTESNFEETLKRLVGELKKSPQEVFDALKSQTIDLVLTAHPTQSVRRS
LLQKHGRIRNCLTKLYAKDITPDEKQELDEALQREIQAAFRTDEIRRAPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYAQIEDLMFELSMWRCTDELRVKADELHRSSKKDTTKHYIEFWKQV
PPSEPYRVILSDVRDKLYNTRERARHLLANGFSEIPDEATFTDVEQFLEPLELCYRSLCT
CGDDSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITQYLGIGSYREWSEEK
RQDWLLSELNGKRPLFGPDLPKTEEIADVLDTFHVLAELPSDSFGAYVISMATAPSDVLA
VELLQRECHVKKPMRVVPLFEKLADLEAAPAALARLFSVEWYRNRINGKQEVMIGYSDSG
KDAGRFSAAWQLYKAQEELIKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDEMAVVAT
KEYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHVLQKDIRNLQILQEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYD
KLLVSEDLWSFGARLRANYEETKQLLLQVAGHKDLLEGDPYLRQRLRIRDSYITALNVCQ
ACTLKRIRDPGFHVSPRAHLSKDIMDSGKPAAELVKLNTTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaatgcggcggacaaggcgacgtccatcgacgcgcagctgcgaatcctggcg
cctaagaagctctcggaggacgacaagctggtcgagtacgacgccctgctcctcgatcgc
ttccttgacatccttcaggatctgcatggggaagacatcagggagacggttcaagaatgc
tatgagtttgctgctgagtatgaaagtaagattgaccccaaacagctggatgcgatcggg
aatgtgttaactcgtttggatcctggagactccatcgtgataacgaagtcgttttcacac
atgcttatcctggcaaacttggctgaggaagtccagattgcgtatcgtaggaggataaaa
ttaaagaagggtgattttgctgatgagaactctgctacaactgaatcaaactttgaggag
accctaaaaaggctcgttggtgagcttaagaaatcccctcaggaggtatttgatgctctc
aagagtcaaacaattgacctggtcctgacagcacatccaactcagtcggtcaggaggtcg
cttctacaaaagcatggcaggataagaaattgtttaacaaaactttatgcaaaggacata
actccagatgagaagcaggaactcgatgaagcacttcagagagagattcaagctgccttt
agaactgatgaaattcggcgagcacctcctacaccacaggatgaaatgcgtgctggaatg
agttattttcatgagacaatatggaagggtgttcccaagtttttacgcagggttgatact
gcccttaagaacattggcataaacgagcgagtgccttataatgctcctcttattcaattt
tcgtcttggatgggtggagaccgtgatggaaatccaagagtcacaccagaggttacaagg
gacgtatgcctgttggctagaatgatggctgctaacttgtactatgcacagatagaggat
ctgatgtttgagctatctatgtggcgttgtactgatgaactacgtgtgaaagctgatgag
ttacaccgttcctcaaagaaagacacaacaaaacactatatagagttctggaaacaggtt
cctccaagcgaaccctatcgtgtaattctgagtgatgtcagagataaattgtacaataca
cgcgagcgggcacgccatttattggccaatggattttctgaaattcctgacgaagcaacc
ttcactgatgttgagcagttcttggagcctcttgagctctgttacagatctctctgtact
tgtggtgatgattctattgctgatggcagtcttcttgactttttgcggcaagtgtccaca
tttggactatcccttgttagacttgatattaggcaggaatctgaccgacatactgatgtt
atggatgccataactcaataccttggaattggatcatatcgtgaatggtcggaggagaaa
cgccaagactggctactgtcagaactcaatggaaagaggccgttatttggtcctgacctt
cccaagacagaggaaattgctgatgttctggatacttttcatgtgttagcagaactaccc
tctgatagctttggtgcatatgtaatatccatggcaacagctccttcagatgttctagca
gttgagcttttgcagcgtgaatgtcatgtgaagaagccaatgagagttgtgccattgttt
gaaaaactggcagatctggaagcagcaccagcagctcttgcccgacttttctctgttgag
tggtatagaaataggatcaatggaaagcaggaagtaatgattggatattcagattctggg
aaggatgctggtcgtttctctgcagcttggcaactgtacaaagctcaagaggagcttatt
aaagttgctaagcagtttggggttaagttgactatgtttcatgggcgtggtggaactgtt
ggaagaggtgggggtcctacccaccttgctatactgtcacaacctccggagaccattcat
ggatcacttcgtgtgactgttcaaggtgaagtcattgagcaatcttttggagaggagcat
ttgtgttttaggacacttcaacgttttacagctgctactcttgaacatggcatgcatcca
ccaatttcaccaaagccagaatggcgtgctctgatggatgaaatggctgttgttgctaca
aaagaataccgatccattgtcttccaagagccgcgatttgttgaatattttcgtcttgcg
acaccagagttggaatatggtaggatgaatattggaagtagaccatcaaaaagaaagcca
agtggaggcattgaatcactacgtgcaattccttggatctttgcttggacacagactcga
ttccacctaccagtgtggcttggttttggcgcagcgttcaagcatgtcttgcaaaaggac
atacgcaatcttcaaatcctccaggagatgtacaacgaatggccatttttcagggttaca
atagacttggttgagatggtgtttgctaagggtgatcctggtattgcagctctgtatgac
aagttgctggtgtctgaggatttatggtcatttggtgctcgtcttagagcaaactatgaa
gaaacaaaacaacttcttctacaagttgctggacacaaagacctccttgagggagatcct
tacttgaggcagagactgcgtatccgtgattcctacattacagcactgaatgtttgccaa
gcctgcacgctaaagcgtatcagggaccctggcttccatgtaagcccccgagctcatctg
tcgaaggacataatggactcagggaagccagctgccgagctcgtgaagcttaacacaacg
agtgagtacgccccaggcctcgaggatactctcatcctgaccatgaagggcatcgctgcc
ggtatgcagaacactgggtga

DBGET integrated database retrieval system