KEGG   Oryza brachyantha (malo sina): 102700506Help
Entry
102700506         CDS       T02995                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
obr  Oryza brachyantha (malo sina)
Brite
Enzymes [BR:obr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102700506
Peptidases [BR:obr01002]
 Cysteine Peptidases
  Family C86
   102700506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 200 aa AA seqDB search
MQPGAKSEADQDEEGSSARVGSGGGGSKVYHERQRLQFCLLHALNNLMQAKESFTRAELD
GIAENLVRVDPNKVQWTPLSMIFKPHHNVFTGNYDVNVLITALESRKKKVVWHDHRKGAS
SIDLDAEALVGLMINVPVRRLRGLWTGRHWLAIRSINGTWFNLDSDFSAPKEFQDKGELI
AFLDSILSQGGEVMIVLRDE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgggagccaaatcagaggcagaccaagacgaggagggatccagtgcgagggta
ggcagcggtggcggcgggagcaaggtgtatcacgaaaggcagcggctgcagttctgtctt
ctccacgccctcaacaaccttatgcaggcaaaggaatctttcacccgagctgagttggat
ggcattgctgaaaatcttgttcgtgtggatccaaataaagtgcaatggactcctctttca
atgatttttaagccccatcacaatgtattcactgggaactatgatgtaaatgtacttatc
acagcattggaatctagaaagaagaaggtagtctggcatgatcatcggaagggggcgtct
tcaatcgatctggatgcagaagcattggttggtctgatgatcaatgttcccgtcaggagg
ttgagagggctttggactggaaggcattggttggcaattagaagcatcaacggtacttgg
tttaatttggacagtgatttttccgcacccaaggaatttcaggacaaaggagaactaatt
gcatttctagacagcattctcagtcaaggtggagaagtcatgattgtgctgcgagatgaa
taa

DBGET integrated database retrieval system