KEGG   Oryza brachyantha (malo sina): 102703008Help
Entry
102703008         CDS       T02995                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
obr  Oryza brachyantha (malo sina)
Brite
Enzymes [BR:obr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102703008
Peptidases [BR:obr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102703008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 331 aa AA seqDB search
MSWCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDAISELRPVYGLIFLFKWMAGEKDE
RPVVKDPNPNLFFASQVIPNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGL
AINNSDSIRTAHNSFARPEPFVSDEQKAAGKDDEVYHFISYLPFEGVLYELDGLKEGPIS
LGQCSGEADDLDWLQMVQPVIQKRIERYSQSEIRFNLMAIIKNRKDVYTAELEELEKRRD
QLLQEMNESSAAESLNSELVNVASAIETVSEKIIMEEEKFKKWRTENIRRKHNYIPFLFN
FLKMLAEKKQLKPLVEKAKQQKASSTSASTR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtgcacgatcgagtctgatcctggtgttttcaccgagttgatccaggagatg
caagtaaaaggtgtgcaggtggaagagctttactctctcgatgtggacgctattagtgaa
ctacggccagtttatgggctaatttttctattcaagtggatggctggggaaaaggatgag
cgacctgtcgtcaaagatccaaacccgaaccttttctttgctagccaggtcatccctaat
gcatgtgctacccaagctattctgtcaattctcatgaaccgcccggaaattgacataggc
ccagaactatccaatctgaaggaattcacaggagcttttgcacctgacatgaagggccta
gctattaacaacagtgactctatccggacagctcacaacagttttgccaggcctgagcca
tttgtctcagatgagcaaaaagctgctggtaaggatgatgaggtctaccatttcataagc
tatttaccttttgaaggtgtcctctatgagcttgatggcttgaaggaagggcccataagc
cttgggcagtgttctggtgaagccgatgaccttgattggctacagatggtgcagccagtt
atacaaaaaagaattgagcgctattcacagagcgagattaggtttaaccttatggccatc
attaagaataggaaagatgtatatactgctgagctggaggagctggaaaagagaagagac
cagcttttgcaggagatgaatgagtcctcagcagcagagtccctaaacagtgaacttgta
aatgtggcatcagctattgagactgtcagtgagaagattatcatggaagaagagaagttc
aagaagtggaggacggagaacatccggaggaagcacaactacattccctttctattcaat
ttcctcaagatgctggcagaaaagaagcagctaaagccattggtggagaaggccaagcag
caaaaggcttccagcacaagcgcgagtaccagatga

DBGET integrated database retrieval system