KEGG   Oryza brachyantha (malo sina): 102706901Help
Entry
102706901         CDS       T02995                                 

Definition
leucoanthocyanidin dioxygenase-like
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    102706901
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     102706901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 336 aa AA seqDB search
MTTEVELRVESLSLSGLSAIPPEYVRPEAERAGLGDAIELAARAASEDPARIPVVDIAAF
DGRLRAAGEAFFALPVAEKERYANDPAAGRLQGYGSKLAANASGQREWEDYLFHLVHPDH
LADHSVWPANPPEYVPVTSDFGARVRELASKLLAILSLGLGLPEETLERRLRSGQEQDED
DDLLLQFKINYYPKCPQPDLAVGVEAHTDVSALSFILHNGVPGLQVHHAGRWVTARTEPG
TIVVHVGDALEILANGRYTSVLHRGLVSREAVRVSWVVFCEPPPESVVLEPVPELLLLAD
GADKPLFAPRTFKQHVQRKVFKMQQDRQQDAGVAAA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggaggtggagctgagagtggagtccctcagcctgagcggcctgtccgccatc
ccgccggagtacgtccgcccggaggcggagcgcgccggcctcggcgacgccatcgagctc
gcggcccgggccgcttccgaggaccccgcccgcatcccggtcgtcgacatcgccgcgttc
gacggacgcctgcgcgcggcgggggaggcgttcttcgcgcttcccgtcgcggagaaggag
aggtacgccaacgacccggcggcggggcggctgcaggggtacggcagcaagctcgccgcc
aacgccagcgggcagagggagtgggaggactacctgttccacctcgtccaccccgaccac
ctcgccgaccactccgtctggccggcgaacccgccggagtacgtgcccgtgacgagcgac
ttcggcgctcgcgtccgggaactcgcttccaagctgctcgccatcctctccctcggcctc
ggcctgccggaagagacgctggagcggcgtctccggtcaggacaggagcaggacgaggac
gacgacctgctcctccagttcaagatcaactactaccccaagtgcccgcagcctgacctc
gccgtcggcgtcgaggcccacaccgacgtcagcgcgctctccttcatcctccacaacggc
gtgccgggcctgcaggtgcaccacgccggccgctgggtcaccgcgcgcaccgagcctggc
accatcgtcgtccacgtcggcgacgccctggagatcctcgcgaacggccgctacaccagc
gtgctccaccgcggcctcgtcagccgcgaggcggtgcgcgtgtcctgggtcgtcttctgc
gagcccccgccggagtccgtggtgctggagccggtgccggagctactgctgctcgccgac
ggcgccgacaagccgctcttcgcgccacgcaccttcaagcagcacgtccagcgcaaggtg
ttcaagatgcagcaggaccggcagcaagacgccggcgttgcagctgcataa

DBGET integrated database retrieval system