KEGG   Oryza brachyantha (malo sina): 102709950Help
Entry
102709950         CDS       T02995                                 

Definition
(RefSeq) alpha-amylase isozyme 3D
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00500  Starch and sucrose metabolism
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102709950
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102709950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 102709950
NCBI-ProteinID: XP_006659494
UniProt: J3MTS1
Position
8
AA seq 439 aa AA seqDB search
MKNYTSSSLCLLLLLVVLCSLTCNSAQGQVLFQGFNWESWKQQGGWYNTLKGQVDDIANA
GVTHVWLPPPSHSVSPQGYMPGRLYDLDASRYGTAAELRSLIAAFRGRGIQCVADVVINH
RCAEKKDARGVYCVFEGGTPDDRLDWGPSMICSDDTEYSDGTGHRDTGEGFAAAPDVDHL
NPRVQRELTDWLDWLKSDVGFDGWRLDFAKGYSTAITKTYVENCKPSFVVAEIWNSLSYN
GDGKPSTNQDQGRQELVNWVNAVGGPAMTFDFTTKGLLQAGVQGELWRLRDGNGKAAGMI
GWLPEKAVTFVDNHDTGSTQKLWPFPADKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEI
IALATIRERNGIHAGSKLRILVADADAYVAVVDEKVMVKIGPRYDVGNVVPSDFHPTVHG
KDYCVWEKGSLRVPAGRHL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactacaccagcagcagcttgtgcctgctgctgcttctcgtggtgctctgcagc
ttgacatgtaactcggcacaaggacaagttctcttccagggtttcaactgggagtcgtgg
aagcagcaggggggctggtacaacacgctcaaaggccaggtcgacgacatcgccaacgcc
ggcgttacccacgtctggctcccgccgccgtcgcactcggtgtcgccgcaggggtacatg
ccggggcggctctacgacctggacgcgtccaggtacggcacggcggcggagctcaggtcg
ctgatcgcggcgttccgcggcaggggcatccagtgcgtcgccgacgtggtgatcaaccac
cggtgcgccgagaagaaggacgcccgcggcgtgtactgcgtgttcgagggcgggacgccc
gacgaccgcctcgactggggccccagcatgatctgcagcgacgacacggagtactccgac
ggcacggggcaccgcgacaccggcgaggggttcgccgcggcgcccgacgtcgaccacctc
aacccgcgcgtccagcgggagctcaccgactggctcgactggctcaagtccgacgtcggc
ttcgacggctggcgcctcgacttcgccaagggatactccacggccatcaccaagacatac
gtcgagaactgcaagccgagcttcgtcgtcgccgagatatggaactcgctgagctacaac
ggcgacggcaagccatcgaccaaccaggaccagggccggcaggagctggtgaactgggtg
aacgccgtcggcgggccggccatgacgttcgacttcaccaccaagggcctactgcaggca
ggcgtgcagggtgagctctggcggctgcgcgacggcaacggtaaggccgccggcatgatc
gggtggctgccggagaaggccgtcaccttcgtcgacaaccacgacaccggctcgacgcag
aagctgtggccgttcccggccgacaaggtcatgcagggctacgcctacatcctcacccac
cccggagtcccctgcatcttctacgaccacatgttcgactggaacctgaagcaggagata
atcgcactggcgacgatcagggagaggaacggcatccacgccgggagcaagctccggatc
ctcgtcgccgacgccgacgcctacgtcgctgtcgtcgacgagaaggtcatggtgaagatc
gggccgaggtacgacgtgggcaacgtggtgccgtcggatttccatcccacggtgcacggc
aaggactactgcgtctgggagaaggggtccctccgtgtcccggctgggcgccacctatga

DBGET integrated database retrieval system