KEGG   Oryza brachyantha (malo sina): 102712659Help
Entry
102712659         CDS       T02995                                 

Definition
alpha-amylase isozyme 3A-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102712659
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102712659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 438 aa AA seqDB search
MGTQVAAMCGLVLVALLRLTPDVAHAQTQILFQGFNWDSWKKQGGWYNMLQGQVNDIASA
GVTHVWLPPPTHSVSPQGYMPGRLYDLDASKYGTKAELKSLIAAFHGKGIKCVADIVINH
RCADDKDSRGVYCIFKGGGPQGCLDWGPSMICSDDTQYSDGTGHRDTGADFAAAPDIDHL
NPLVQRELSDWLRWLRRDVGFDGWRLDFAKGYSAAVAKAYVQNARPGFLVAEIWSSLSYD
GDGKPAANQDGERQELVNWVKQVGGPATAFDFTTKGILQSAVQGELWRMRDKDGKAPGMI
GWLPEKTVTFVDNHDTGSTQRMWPFPSDKVMLGYAYILTHPGVPCIFYDHVFDWNLKQEI
NALAAARRRNGINAGSKLRILAADADMYVAMVDERVITKIGPKTDVGSMIPSDFHVVAHG
NDYCVWEKSGLRVPAGRR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggggacgcaagtcgccgccatgtgtggcctcgtcctcgtggcgttgctccggctgaca
cccgacgtcgcgcacgcacagacgcagatcctcttccaggggtttaactgggactcgtgg
aagaagcagggcgggtggtacaacatgctccagggccaggtgaacgacatcgccagcgcc
ggcgtcacgcacgtctggctcccccctccaacccactccgtctcacctcaaggctacatg
ccggggcggctctacgacctggacgcgtccaagtacggcaccaaggcggagctcaagtcg
ctcatcgccgccttccacggcaagggcatcaagtgcgtcgccgacatcgtcatcaaccac
cgctgcgccgacgacaaggacagccgcggcgtctactgcatcttcaagggcggcggcccg
caaggctgcctggactggggcccctccatgatctgcagcgacgacacgcagtactccgac
ggcacgggccaccgcgacaccggcgccgacttcgccgccgcgcccgacatcgaccacctc
aacccgctcgtccagcgggagctctccgactggctcagatggctcaggagggacgtcggc
ttcgacggctggcgcctcgacttcgccaagggctactcggcagccgtggccaaggcgtac
gtccagaacgccaggccgggcttcctcgtcgcggagatatggagctccctcagctacgac
ggcgacgggaagccggcggccaaccaggacggcgagcggcaggagctcgtgaactgggtg
aagcaggtgggcggcccagccacggcgttcgacttcacgaccaagggcatcctgcagtcg
gcggtgcagggcgagctgtggcggatgcgggacaaggacggcaaggcgccgggcatgatc
ggctggcttcccgagaagaccgtcaccttcgtcgacaaccacgacaccggctcgacgcag
cggatgtggccattcccgtctgacaaggtcatgctgggctacgcctacatcctcacccac
ccaggagtcccatgcatcttctacgaccacgtgttcgactggaacctgaagcaggagatc
aacgcgctggcggcggcgaggaggcgcaacgggataaacgccgggagcaagctgcgcatc
ctggcggcggacgccgacatgtacgtcgcgatggtcgacgagagggtcatcaccaagatc
ggaccgaaaacggacgtgggcagcatgatcccgtcggatttccacgtcgtggctcacggc
aatgactactgcgtgtgggagaagagcggtctcagagtcccagcagggcgccgctag

DBGET integrated database retrieval system