KEGG   Oryza brachyantha (malo sina): 102712687Help
Entry
102712687         CDS       T02995                                 

Definition
putative ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102712687
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102712687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 215 aa AA seqDB search
MLMPDGQNSIIIVGGANMEGWAAGVGSDDLDLIRQAGVLLLQREIPDWVNVQVAQAAKDA
GVPVILDAGGMDAPVPGELLSLVDIFSPNETELARLTGMLTETFEQISRAAGACHKMGVK
EVLVKLGSQGSALFIEGKEPIRQPIIPATEVVDTTGAGDTFTSAFAVALVEGKPKKECMR
FAAAAASLCVQVKGAIPSMPDRKSVMDLLESVQVE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgcccgacgggcagaactccatcatcatcgtcggcggcgccaacatggagggg
tgggccgcaggggtcggctcggacgacctggacctgatccggcaggctggtgtgctgctg
ctgcagagggagatacccgattgggtcaacgtgcaggttgctcaggctgcaaaagatgca
ggtgtgcctgttattttggatgccggtggaatggatgctcctgtccctggagaactactc
agcctggtggacatttttagtccaaatgaaacagaacttgcacgtttgactgggatgctt
acagaaacatttgaacagatcagccgagctgcaggagcatgccataaaatgggtgtaaaa
gaagtgctggttaaactcggatcacaaggatctgctttatttatcgaagggaaggaacca
atcaggcagccgataattcctgccacagaagttgttgatacgactggtgctggtgacact
ttcacctcagcttttgctgtagctctagttgagggtaaacctaagaaagagtgcatgaga
tttgctgctgctgctgcatctctgtgtgttcaagtaaagggagccatacccagcatgcct
gatcgaaaatcagtgatggaccttctggaatctgttcaggttgaataa

DBGET integrated database retrieval system