KEGG   Oryza brachyantha (malo sina): 102712963Help
Entry
102712963         CDS       T02995                                 

Definition
(RefSeq) uncharacterized LOC102712963
  KO
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102712963
Enzymes [BR:obr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102712963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 439 aa AA seqDB search
LLLLLLLSRSLRADRDAVVSRIAFGSCANQSAPQPVWEAVVGFDPQVFIWLGDNVYGDNK
RPFRAWGKERTVGPWRNVPRFYPSPEDELRRRYEMAKAKPGYAKLRERAQVIGTWDDHDY
GLNDAGKEFSGKVINQRLLLDFLDEARDSSRRQQAGVYTSYMFGPEGKRVKVILLDTRYH
RDPLLSDGAILGDPQWQWLERELHGPRSEITIIGSSIQVISNLSATTGPLFYVESWARFP
RERERLFRLIDSSKRNGVLFISGDVHFGEISRYDCGAQYPLYDITSSGLTQSVENSVPAV
FQPLFRLLALLTPTTTRVFSPNCRYKSCTYGQPNFGAIEIHWDAVPPKIKLDLRDIQGNS
VGDVEFPISELELSNTHDIKKQGHSYQHCTLETELSWVVRYRLALLFFGTVAVSGIAVVL
IVIVCLSTTNIFTKKSKME
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ctcctcctcctcctcctcctctcccgctccctccgcgccgaccgcgacgccgtcgtgtcc
aggatcgccttcggctcctgcgccaaccagagcgcgccccagcccgtgtgggaggccgtc
gtggggttcgacccgcaggtgttcatctggctcggggacaacgtctacggcgacaacaag
aggccgttccgggcgtgggggaaggagaggacggtggggccatggaggaacgtgccgcgg
ttctacccgtcaccggaggacgagctgcggaggcgatacgagatggccaaggccaagcca
gggtacgccaagctcagggagagggctcaggtcattggaacatgggatgatcatgattat
ggattgaacgatgcaggaaaagagtttagtgggaaagtgatcaatcaaaggcttctatta
gattttttggatgaagctagagatagttcacggaggcaacaagctggtgtttatacctca
tacatgtttggccctgaaggaaaacgagtaaaggtaattctgttggacaccagatatcac
agagaccctctcctaagtgatggagctatactgggagatcctcagtggcaatggctggag
agggagctgcatggtcctcgatcagagatcaccatcattggatcatcaatacaagtaata
tcaaatctatctgccaccactggacctttattctatgtggagtcatgggcacgttttcca
agggaaagagaacgactgtttagattgatcgatagcagtaagagaaatggagtgttattt
atcagcggtgatgttcattttggagaaatttctcgctacgactgtggggctcaatatcca
ttgtatgatattacctcaagtggtcttacccaatctgtcgagaactctgtaccagcagta
tttcaacccctctttagacttctggcattgttgacaccaaccactacgcgagtcttcagc
cctaactgccgttacaaatcatgcacatacggtcagccaaactttggagcaatcgagata
cattgggatgcagtacctcccaagattaaactcgatctgagagatatacagggaaactct
gttggtgacgtggagtttcccatatctgaactggagctatcaaacacacatgacattaaa
aaacaggggcattcgtatcagcattgcactctcgaaacagagctttcatgggtagtgcga
taccggcttgctctgttattctttggtacagttgctgtttctgggatagccgtggtgttg
atagtaattgtctgcttgtcaactactaatattttcaccaagaaatccaagatggaataa

DBGET integrated database retrieval system