KEGG   Oryza brachyantha (malo sina): 102713297Help
Entry
102713297         CDS       T02995                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 7-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102713297
   00500 Starch and sucrose metabolism
    102713297
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     102713297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
9
AA seq 600 aa AA seqDB search
MARLGLAVCAAVCFHLCILISSSSSIPAETGSHAVRRTAYHFQPAKNWQNDPNGPMYHNG
MYHLFYQYNPRSALWDTGNLSWGHSVSGDLVNWAALPTALDPTSPFDANGCWSGSATILP
GGLPAILYTGIDSRKQQVQNVAFPKNPSDPLLREWEKPARHNAVIALPADVPGDRFRDPS
TAWLGGDGLWRTAVSAEVDGVASTLVYRSSDFLRWERSAAPLHASRAAGMVECPDLFPVA
EHGRAGLDTSANGAGVRHVLKLSVMDTLQDYYMVGWYNDTADAFSPAEPERGDDCRSWRR
LDYGHVYASKSFFDARKNRRVLWAWANESDSQADDVARGWSGVQTFPRELWLDEDGKQLL
QWPVEEIETLRRKRAGLRRGGTRMLDAGALQEIVGVASSQADVEGLFKIPSLQDPSLEEA
ERLDDDPNRLLDPQKLCGEKGATVRGGVGPFGLLVLASGDLHEHTAVFFRVFRHHDKFKL
LMCTDLTKSSTRAGVYKPTYGGFIDMDIEEHKTISLRTLIDHSVVESFGGGGRACMTARV
YPEHAAAARSSHMYVFNNGSDAVRVSKLEAWELATATVNGVGGGGHGLAAAVAPARHSDA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattaggtcttgccgtgtgcgccgccgtctgcttccacctctgcattcttatc
tcgtcgagctcctccatccccgcagagacaggcagccatgccgtcaggagaactgcctac
cacttccagcctgcgaagaactggcagaatgatccgaatgggccaatgtaccacaacggc
atgtaccacctgttctaccagtacaacccgcggagcgcgctctgggacaccggcaacctc
tcctggggccactccgtctccggcgatctcgtcaactgggccgccctccccacggcgctc
gaccccacctcgccgttcgacgccaatggctgctggtcgggctccgccaccatcctcccc
ggcggtctccccgccatcctctacaccggcatcgactcccgcaagcagcaggtgcagaac
gtcgccttccccaagaacccctccgacccgctcctccgcgagtgggagaagcccgcgcgg
cacaacgcggtgatcgcgctcccggccgacgtccccggcgaccgtttccgcgacccctcg
acggcgtggctcggaggcgacggcctgtggcgcaccgccgtctccgccgaggtggacggc
gtggcgtccacgctcgtctaccggagcagcgacttcctccgctgggagcggagcgccgcg
ccgctgcacgcctcgcgcgccgcgggcatggtggagtgcccggacctgttccccgtggcg
gagcacgggagggcgggcctcgacacgtcggcgaacggcgccggcgtccgccacgtgctg
aagctgagcgtgatggacacgctccaggactactacatggtcggctggtacaacgacacg
gcggacgccttctcgccggcggagcccgagcgcggcgacgactgccggagctggcggcgc
ctcgactacggccacgtgtacgcgtccaagtcgttcttcgacgcgcgcaagaaccgccgc
gtgctgtgggcgtgggccaacgagtccgacagccaggccgacgacgtcgcccgcggctgg
tccggcgtgcagacgttcccgagggagctgtggctggacgaggacggcaagcagctgctg
cagtggcccgtcgaggagatcgagacgctgcggaggaagcgcgccggtctccggcgaggc
ggcaccaggatgctggacgccggcgcgctgcaggagatcgtcggcgtggcgagctcgcag
gccgacgtggaggggctgttcaagatcccgagccttcaagatccgagcctggaggaggcc
gagaggctggacgacgacccaaaccggctgctggatccccagaagctgtgcggcgagaag
ggcgccaccgtgcgaggcggcgtcgggccgttcgggctcctcgtgttggcctccggcgac
ctgcacgagcacaccgccgtcttcttcagggtgttcaggcaccacgacaagttcaaactc
ctcatgtgcactgacctgacaaagtcgtccacaagagcaggtgtgtacaagccgacctac
ggcggattcatcgacatggacatcgaggagcacaagaccatatcgcttagaaccttgatt
gaccattcggtggtggagagcttcggcggcggcgggcgggcgtgcatgacggcgcgagtg
tacccggagcacgcggcggcggcgaggagcagccatatgtacgtgttcaacaacgggagc
gacgccgtgagggtgtccaagctggaggcgtgggagctggcgacggcgacggtgaacggt
gttggcggcggcggccacggccttgcagctgccgttgcgccggcacggcacagcgacgcc
taa

DBGET integrated database retrieval system