KEGG   Oryza brachyantha (malo sina): 102714596Help
Entry
102714596         CDS       T02995                                 

Definition
steroid 5-alpha-reductase DET2-like
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    102714596
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102714596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 236 aa AA seqDB search
MGGGGGEDDALYAPCLVTLYLLSPVTVFLLRFVSAPYGKLSRPGWGPSVPAALAWFLMES
PTLWLPPFVLSAAATFHPLRLLRLRSAPAPVPILVAALAFGFNLLNAYVQAHSWALHAAT
TAGAVARRLVGLALFAWGMRTNIAADKELLRLKEAGKGYQIPRGGLFDVITCPNYFGEAV
EWLGYALVAWTPAAWGFFLYACANLGPRARDHRRWYVGKFGDKYPASRKAFVPYVY
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcggcggcggcgaagacgacgcgctgtacgccccgtgcctggtcacgctgtat
ctgctcagcccggtcaccgtgttcctgctcaggttcgtgtcggcgccgtacgggaagctc
tcccgcccggggtggggtccctccgtgccggcggcgctcgcgtggttcctcatggagagc
cccaccctctggctcccgccctttgtcctctccgccgccgccaccttccacccgctccgg
ctcctccgcctgcgcagcgccccggcgcccgtgccgatcctcgtcgccgcgctcgccttc
ggcttcaacctcctgaacgcctacgtccaggcgcactcctgggcgctccacgccgccacg
accgccggcgccgtcgcccgccgcctcgtcgggctggcgctcttcgcgtgggggatgcgg
accaatatcgcggcggacaaggagctcctgaggctcaaggaggccgggaaagggtaccag
attccccgcggcgggctgttcgacgtgatcacctgccccaactacttcggcgaggccgtg
gagtggctcggctacgccctggtggcgtggacgcctgcagcctggggcttcttcctctac
gcctgcgccaacctcgggccgagggccagggatcaccgccggtggtacgtcggcaagttc
ggcgacaagtacccggcgtcacgcaaggcattcgtcccgtacgtctactag

DBGET integrated database retrieval system