KEGG   Oryza brachyantha (malo sina): 102716756Help
Entry
102716756         CDS       T02995                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
obr  Oryza brachyantha (malo sina)
Brite
Enzymes [BR:obr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102716756
Peptidases [BR:obr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102716756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 229 aa AA seqDB search
MGKRWIPLEANPDVMNQFMWGLGVAEGEAQFCDVYGLDDELLAMVPQPVLAVLFLYPLTS
LDDEEEESGASATSTVGDKDLSKRVYFTKQTVGNACGTVGVIHAIGNAASKLKLVEGSYF
DRFYKQTADMDPVQRAAFLEEDDEMEDAHSVAASAGDTDANVEVNEHFVCFSCVDGELYE
LDGRKSQPTCHGPSSPDTLLQDAAKVIKARISSNPDSMNFNVMALSKVM
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcggtggatccctctcgaggccaaccccgacgtcatgaaccagttcatgtgg
gggctgggggtcgccgaaggggaggcgcagttctgcgacgtctacggcctcgacgacgag
ttgctcgcgatggtgccccagcccgtgctcgccgtccttttcctctacccgctcacttcg
ttggacgacgaggaggaggaatcgggcgcttctgccacttccacggttggggacaaggac
ttgagcaagagggtatactttacgaagcagactgttggcaacgcatgtggaacagttggt
gtcattcatgcaataggaaatgctgcatccaaactcaagctggttgaaggatcttatttt
gataggttttataaacaaacagctgatatggatccagtccagcgtgctgcctttcttgag
gaggatgatgagatggaggatgctcattctgttgctgcttcagctggtgacactgatgct
aacgttgaggtgaatgagcattttgtatgtttctcatgtgttgatggtgaactttatgag
cttgatggacgaaaatcgcaaccaacatgtcatggcccttcatcaccagatactttgtta
caggatgctgcaaaagttatcaaagccagaatttcgtcgaaccctgactcaatgaacttc
aacgtgatggctctttctaaagttatgtaa

DBGET integrated database retrieval system