KEGG   Oryza brachyantha (malo sina): 102717150Help
Entry
102717150         CDS       T02995                                 

Definition
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00052  Galactose metabolism
obr00500  Starch and sucrose metabolism
obr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102717150
   00500 Starch and sucrose metabolism
    102717150
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     102717150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357 FLgD_tudor
Motif
Other DBs
NCBI-GeneID: 102717150
NCBI-ProteinID: XP_015691526
Position
4
AA seq 624 aa AA seqDB search
MIPAISPIMDGAAPLLPETSPESQHRDPARARKRQPAIITAVLPAVASAVVLLGLAALFL
VYGFRDEGRADVVAPGAVEVVVASSSSRGVVEGVSEKSNAPSLRLGGGKVRDYDWTNAML
SWQRTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLH
LPLAMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEESVQVENVATAWRSRADSAWRI
TIGSKNRDHAGVALVYKTDDFLHYDLLPTLLHVVKGTGMWECVDFYPVSATPGVEVGLET
STEPGPGVKHVLKASLDDDRNDYYAIGTYDGKAADTWTPDDAEIDVGIGLRYDYGKFYAS
KTFYDPVGRRRVLWGWIGETDSERADILKGWASVQSIPRTVLLDTKTGGNLLQWPVVEVE
NLRMRVKSFDGLAISPGTIVPLDVGKATQLDIEAVFQVNNLITDGVTAVDAGAAAYSCST
GGGAVGRGLMGPFGLLVLADQELTEQTAVFFYLVKGADGNLTTFFCQDELRSSKANDLVN
RVYGSLVPVLNGESLSIRILVDHSIVESFAQGGRTCITSRVYPTKAIYESAKIFLFNNAT
NVGVTAKSLKIWELNSAYIRPYVD
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggccatctccccgatcatggacggcgccgccccgctgcttcccgagacgagc
cccgagagccagcaccgtgatccggcgagggcgaggaagcggcagccggccatcatcacc
gccgtcctccccgccgtcgcgtccgccgtggtcctgctcggcctcgccgcgctgttcctg
gtctatgggtttcgcgatgaagggagggccgacgtcgtcgcgcccggcgccgtggaggtt
gttgtggcctcgtcgtcgtcccgcggcgtggtggagggcgtgtcggagaagtcgaacgcc
ccgtcgctccgcctcggcggcggcaaggtccgggactacgactggaccaacgcgatgctg
tcgtggcagcgcacggcgttccacttccagccccctaacaattggatgaacgatccgaac
ggtccactatactacaagggatggtaccatctgttctaccaatggaacccggactcggcc
gtgtgggggaacatcacctggggccatgccgtgtcgcgcgacctcatccactggctgcac
ctgcctctggccatggtgccggatcactggtacgacatcaacggcgtctggaccggctcg
gcaacgcagctgcccgacggccggatcgtcatgctctacaccggcgccacggaggagtcg
gtgcaggtggagaacgtggccacggcgtggcgcagccgggccgactcggcgtggcggatc
accatcggctccaagaaccgcgaccacgccggggtggcgctcgtgtacaagaccgacgac
ttcctgcactacgacctgctccccacgctgctgcacgtcgtgaagggcaccggcatgtgg
gagtgcgtggacttctacccggtgtccgccacgccgggcgtcgaggtcgggctcgagacg
tccaccgagccgggccccggcgtgaagcacgtgcttaaggccagcctcgacgacgacagg
aacgactactacgccatcggcacctacgacggcaaggccgccgatacctggacgccggac
gacgccgagatcgacgtcgggatcgggctccgctacgactacggcaagttctacgcgtcc
aagacgttctacgatcccgtcggacggcggcgcgtgctgtgggggtggatcggtgagacc
gacagcgagcgggctgacatactcaagggctgggcctccgtccagtcaattccgaggact
gttctcctagacacgaagacagggggcaacctgctccagtggccggtggtggaggtggag
aacctccgtatgcgtgtcaagagctttgatggccttgctatctctcccggcaccatcgtg
ccattggatgtcggcaaagcaacacagctagacatcgaggctgtgttccaggtgaacaat
ttgattaccgatggcgtcaccgctgtggacgctggagcggcagcgtacagctgtagcaca
ggcggcggcgcggtgggtcgaggcttgatgggcccattcgggcttcttgtgctagctgac
caggagttgacggagcagacagctgtcttcttctacctggtcaagggagcagatggcaac
ctcacaaccttcttctgccaagatgagctcaggtcatcaaaagcaaatgatcttgttaac
agagtctatggtagcttggtacctgtgttgaatggcgaaagcctatcaataagaatattg
gttgaccactccatagttgagagctttgctcaaggagggaggacatgcattacctcgcgt
gtttaccccactaaagcgatctatgaatccgccaaaatctttctattcaacaatgccaca
aatgttggagtcactgcaaaatcgctaaagatttgggagctgaattctgcttacattcgt
ccatatgtagactag

DBGET integrated database retrieval system