KEGG   Oryza brachyantha (malo sina): 102717934Help
Entry
102717934         CDS       T02995                                 

Definition
probable choline kinase 2-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102717934
Enzymes [BR:obr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102717934
    2.7.1.82  ethanolamine kinase
     102717934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 368 aa AA seqDB search
MVAVDPPPQEAAAPPASMKRSASFDRVPEEARRILHRLAGELWGGDVDPCALAVSQLKGA
MTNEVFRITWPGDGEGEGDGEGDHRKVLVRIYGQGVEVFFDRDDEVRTFECMSRHGQGPR
LLGRFPNGRIEEFINARTLSAADLRDPEISSLIAKKLREFHDLDMPGPKNASLWQRLRRW
LEEARGRCSAEEAREFSLEKLGDEIAMLDSSLSGIDQRVGFCHNDLQYGNIMIYESTRQV
TLIDYEYASFNPVAFDIANHFCEMSADYHSATPHVLDFTKYPGIEEQRRFVQTYLSYSGE
NPSDVEVDHLLGLISKYTLASHLFWGLWGIISAHVNKNIDFEYKVYAGQRFDQYWQTKDK
TLAANLTR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgtcgacccgccgccgcaggaggccgctgccccgcctgcctccatgaagcgg
agcgccagcttcgaccgcgtccccgaggaggcgcgccgcatcctgcaccgcctcgccggc
gagctctggggcggcgacgtcgacccctgcgcgctcgccgtgtcccagctcaagggcgcc
atgaccaacgaggtgttccggatcacctggcccggcgacggcgagggtgagggtgacggc
gagggcgaccaccgcaaggtgctcgtccgcatctacggccagggcgtcgaggtcttcttc
gaccgcgacgacgaggtccgcaccttcgagtgcatgtcccgccacggccagggcccccgc
ctcctcggccgcttccccaacggccgcatcgaggagttcatcaacgcgaggactctctcg
gcggcggatctgcgcgacccggagatatcctcgctgatcgccaagaagctgcgcgaattc
cacgatctcgacatgcctggacccaagaacgcctcattgtggcagaggctgaggcggtgg
ctcgaggaagctcgtggcaggtgctcagcggaggaggccagggagttcagtttggagaag
ctgggtgatgagattgcaatgctggacagttcattgtcagggattgatcagagagtagga
ttttgccacaatgatctgcaatacgggaatattatgatttatgaatcaaccagacaagtg
actttaatagactacgagtacgccagctttaaccctgtggcattcgacattgctaatcac
ttctgtgagatgtctgctgattatcattcagccacaccgcatgttctagactttacaaaa
taccctggcattgaggaacaacgcagatttgttcagacctacctcagctattcaggtgaa
aacccgtcagatgtggaagttgatcatttacttggcttaatctcaaaatacactcttgca
agccatctcttctggggtctttggggaataatctcagcgcatgtgaacaagaacatcgac
tttgagtacaaggtttacgcagggcagcggttcgatcagtactggcagacaaaggataaa
acactggcagccaatctaactagatga

DBGET integrated database retrieval system