KEGG   Oryza brachyantha (malo sina): 102720741Help
Entry
102720741         CDS       T02995                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:obr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102720741
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102720741
Enzymes [BR:obr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102720741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 975 aa AA seqDB search
MVSSNLFHCRRNSWPAEEYVGRTALQLLDFDGGSPPEQAWRRRLNSHANLLKEFSVTFME
AMRMMSLGLRLWSYVREEASHGRKAPIDPFTKEKCKPSASQGVPLGGMGSGSISRGFRGE
FKNWHIIPGLCETSPVMENQFSIFVSRDGGNKKFSSVLSPGHHEGLRKCNDDSGISSWDW
NLSGQHSTYHALFPRAWTVYDGEPDPDLKISCRQISPFIPHDYKDSSLPTSVFVYTLVNT
GKDRAKVSLLMTWANSIGGFSHHSGGHFNEPFIAEDGVSGVLLHHKTAKDNPPVTFAIAA
CETQNVNVTVLPVFGLSGEGQVSAKQMWDKMAQNGHFERENFEAGSSMPSSSGETLCAAV
SASTWVEPHGRCTVVFGLAWSSPKIKFQKGCTYNRRYTEFYGTSERSAVNLVHDALTKYK
IWEEEIEKWQNPILKNERLPEWYKFTLFNELYFLVAGGTVWTDGQPPMIDEKTNPGSNQQ
KSSKRGTRDNKQESVKDNHVKLTAEQVANGGDLTDGEERSVSKYAAVHGSQMVEPTNGLG
PQEPIPYLLSKKGPENVGKFLYLEGVEYIMWCTYDVHFYASFALLDLFPKIELSIQRDFA
NAVLYEDRRRMKFLADGTSGIRKVKGAVPHDLGTHDPWHEMNAYNIHDTSKWKDLNPKFV
LQVYRDFAATGDMSFGRDVWPAVCAAMDYMDQFDRDGDGLIENDGFPDQTYDAWTVHGIS
AYCGGLWLAALQAAATMAHRLGDRAFAEKYKLKFIKAKAVYEAKLWNGSYFNYDSGTSSN
SRSIQADQLAGQWYAASSGLPPLFDEQKIRSALQKIFEFNVMKVKGGRLGAVNGMTPSGK
VDETCMQSREIWTGVTYGVAANMLLHGMEHQAFTTAEGIFIAGWSEDGYGYWFQTPEGWT
MDGHYRSLIYMRPLAVWAMQWALSPPKAILDAPKVNLMDRIHLSPQMIRAMNEISVRKIA
PDNRCFPSSAFRCQC
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcagcaacctcttccactgccggaggaactcgtggccggccgaggagtacgtc
ggccggaccgcgctgcagctgttggacttcgacggcgggtcgcctccggagcaggcatgg
cggcggcggttgaacagccacgccaacttactcaaggagttcagcgttaccttcatggaa
gcaatgaggatgatgagccttgggctgaggctatggtcgtatgttcgtgaggaggcttcg
catggaaggaaagctccaattgatccgtttaccaaagagaaatgtaagccgtcagcttcg
cagggtgtaccgcttggtgggatggggagtggtagcatttcaagaggtttcaggggagag
ttcaagaattggcacatcattcctggcttatgtgagacctcgccagtcatggagaaccag
ttttctatatttgtatctcgcgatggggggaacaaaaagttctcatcagtcttgtctcct
ggacatcatgaaggtttaaggaagtgtaatgatgactctggaatttcttcatgggactgg
aacttgagcggtcaacattctacctatcatgcattgtttcccagggcatggactgtttat
gatggtgaaccagatccagatcttaaaatctcatgtcgtcagatatcaccattcattcct
catgattacaaagatagcagcctcccaacttctgtctttgtgtacactctagtgaacact
ggaaaagaccgtgcaaaagtaagcctgttaatgacgtgggcgaactctattggaggtttt
tctcatcactcaggaggccactttaatgagcccttcattgcggaggatggggtctctgga
gttcttctgcatcacaaaacagcaaaggataatcctccggttacttttgctattgctgcc
tgtgaaactcagaatgtgaatgtgacagtcttgcctgtatttggcctctcaggagaaggt
caagtttcagccaagcaaatgtgggataaaatggctcagaatggccactttgaacgagaa
aattttgaagctggttccagtatgccttcgtcatcaggggagacactttgtgcagctgtc
tcggcttcaacctgggtagagccacatggtagatgtactgttgtgtttggtttagcctgg
tcctctcctaaaataaagtttcagaagggatgcacatacaacaggaggtacaccgaattt
tatggaacttctgaaagatcagctgttaatttggtacatgatgccttgacaaaatataaa
atttgggaggaggagattgaaaagtggcaaaaccccatactcaagaatgaaagacttcca
gaatggtataagttcacactttttaacgagctttactttctagtagctgggggtactgtt
tggacagatggccaaccaccaatgattgatgaaaaaacaaatcctggttctaatcaacaa
aaatcttcaaaaaggggcactagagacaataaacaggaatcagttaaagataaccatgtc
aaactgacagcagagcaagttgctaacggaggtgatctcactgatggtgaagagcgaagc
gtgtcaaagtatgcagcagttcatggatcgcaaatggttgaaccaaccaatggacttggt
ccacaagagccaataccgtacttgctttctaagaaaggccctgaaaatgttggcaaattt
ttgtacctggagggagtggaatacatcatgtggtgcacctatgatgtgcatttctatgct
tcttttgctcttcttgatctgttccccaaaatagagctgagcatccaacgtgattttgcc
aatgccgttctgtatgaagacagacggagaatgaaatttttggctgatggtacttccgga
attcgcaaggtcaaaggtgctgttcctcatgacctaggaacacatgatccatggcatgaa
atgaatgcatacaacatacatgatacaagcaaatggaaagatttaaacccaaaatttgtg
ctccaggtatacagagactttgctgctactggtgatatgtcatttggtagagatgtttgg
cccgcagtttgtgcagcaatggactatatggatcaatttgaccgtgatggtgatggtctc
attgaaaatgacgggtttcccgaccaaacctatgatgcctggactgttcatgggattagt
gcttactgtggcggtctctggcttgctgcacttcaggctgcagccacaatggctcatcgg
cttggtgatcgggcatttgctgaaaagtacaagctcaaattcataaaagccaaagcagta
tatgaggctaagttatggaatgggtcttacttcaattatgacagcggcacaagcagtaat
agccgatctattcaggctgatcagctagcagggcagtggtatgctgcttcctcaggcttg
cccccgctctttgatgagcaaaaaataagaagcgccctgcagaaaatattcgagttcaac
gtaatgaaggttaaaggaggacgactgggagctgtaaatggtatgactcccagtggaaag
gtggatgagacatgcatgcaatctcgggaaatctggactggtgttacatacggtgttgct
gcaaacatgctgctccatggaatggagcatcaagcattcaccacagcggaaggaattttt
attgctgggtggtcagaagatggatatgggtactggttccagacaccggaaggatggacc
atggacgggcactatagatcactgatctacatgcgacctcttgctgtttgggcaatgcag
tgggcactctctcctcccaaggcaattctcgatgcccccaaggtaaacctgatggacagg
atacacctatccccacaaatgatccgagcaatgaacgagattagtgttagaaagatagca
cccgacaatagatgtttccctagctctgcatttcgttgtcaatgttaa

DBGET integrated database retrieval system