KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4085Help
Entry
OCAR_4085         CDS       T00783                                 

Gene name
argJ
Definition
bifunctional ornithine acetyltransferase/N-acetylglutamate synthase (EC:2.3.1.1 2.3.1.35)
Orthology
K00620  
glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:oca01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:oca01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:oca00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86072..87325
Genome map
AA seq 417 aa AA seqDB search
MSTTVSPLAPASVPTLPVIAGVRLATAAAGIRYKGRTDVLLALFDEGTTVAGVFTKSKCP
SAAVDWCRERLAGGKSSKGGLARALVVNSGNANAFTGKTGKAATKLTADIAARAIKANAG
QIFLASTGVIGEPLDATKFNGVLDDLASRAAPESWEEAARAIMTTDTFPKLATKTVKLGK
ARVTINGIAKGAGMIAPDMATMLSFVFTDAPIAAPALQALLKSGVEDTFNAVTIDGDTST
SDTLLAFATGAAKDAPRISRASDPRLKAFAKAFREVLADLAEQVARDGEGARKLVEVLVE
GAVSKASARRVAMSIANSPLVKTAIAGEDANWGRVVMAVGKAGEPADRDKLAIFFNGVRV
AYKGMRDPSYDEAEVSALMKQPKITIKAALGLGKGRDRVLTCDLTKEYVAINGDYRS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaccgtctctcctctcgcgcccgcatccgttcccactctgccggtcattgcc
ggcgtgaggctcgccaccgccgccgccggtatccgctacaagggccgcaccgacgtgctg
ctcgctttgttcgacgagggcaccacggtcgctggtgtcttcaccaagtcgaaatgccca
agcgcagccgtcgactggtgccgtgagcggcttgcaggcggcaaatcatccaagggtggg
ctcgcccgcgctctggtcgtcaattccggcaacgccaacgccttcaccggcaagaccggc
aaagctgcgacaaagctcactgccgacatcgccgcacgcgccatcaaggcaaacgccggg
cagatcttcctcgcctcgaccggcgtgatcggcgagccgctcgacgccaccaagttcaat
ggtgtgctcgacgacctcgcctcgcgtgcggcgccggagagctgggaggaagccgcgcgt
gcgatcatgaccaccgacaccttcccgaagctcgcgaccaagaccgtgaagctcggcaag
gcccgcgtcaccatcaacggcatcgccaagggtgccggcatgatcgcacccgatatggcg
acgatgctctccttcgtgttcaccgacgcgccgatcgccgcacccgcgctgcaggcgctt
ctgaaaagcggcgtcgaagataccttcaacgcggtgacgatcgacggcgacacctcgacc
tctgacacactgctcgcattcgcaaccggcgccgcgaaggatgccccgcgcatcagccgc
gcctccgacccgcgcctcaaggcgttcgccaaggcgtttcgtgaggtgcttgccgatctc
gccgaacaggtcgcccgcgatggcgaaggtgcacgcaagctcgtcgaagtcttggtcgag
ggtgcggtatcgaaggcgtctgctcgcagagtcgcgatgtcgattgcgaactcgccgctg
gtgaaaaccgcaatcgccggtgaggacgccaactggggccgcgtggtgatggcggtgggc
aaggccggcgagccggccgaccgtgacaagctcgcgatcttcttcaacggcgtgcgcgtt
gcctacaaaggcatgcgcgaccccagctatgacgaggccgaagtgtcggcgctgatgaag
cagccgaagattaccatcaaggccgcgctcggccttggcaagggccgcgaccgcgtgctg
acctgcgacctcaccaaggagtatgtcgcaatcaacggcgattacaggtcgtga

DBGET integrated database retrieval system