KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4288Help
Entry
OCAR_4288         CDS       T00783                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_4288 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCAR_4288 (sdhD)
   00650 Butanoate metabolism
    OCAR_4288 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    OCAR_4288 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278519..278923
Genome map
AA seq 134 aa AA seqDB search
MSSRTDKNVSMRTPLANVRRLGAAHGGTSDFFRQRLTAVAMALLMIPVAVIVIMLVGRDQ
ASAQALLGSPVVAILLTLFIIAGCVHMKIGVQVVIEDYVHSEAAKISAILANNFFSFAVG
LASIYAIFKLSVGS
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccgcaccgacaaaaacgtttcgatgcgcacgccgctcgccaatgtgcgccgc
ctcggcgcggctcatggcggcacctccgatttcttccgccagcgcctcaccgcggttgcg
atggcgctgctgatgatcccggtcgcggtgatcgtcatcatgctggtcgggcgcgatcag
gcctcggcgcaggcgcttctcggctcacctgtcgtcgccatcctcctcacgctcttcatc
atcgccggctgcgtgcacatgaagatcggcgtgcaggtcgtgatcgaggattacgtgcac
agcgaagcggccaagatctccgcgatcctcgccaataatttcttctcgttcgctgtcggg
ctcgcctcgatctacgcgatcttcaagctgtcggtcgggagttaa

DBGET integrated database retrieval system