KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4288Help
Entry
OCAR_4288         CDS       T00783                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00020  Citrate cycle (TCA cycle)
oca00190  Oxidative phosphorylation
oca00650  Butanoate metabolism
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01120  Microbial metabolism in diverse environments
oca01130  Biosynthesis of antibiotics
oca01200  Carbon metabolism
Module
oca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oca_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCAR_4288 (sdhD)
   00650 Butanoate metabolism
    OCAR_4288 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    OCAR_4288 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACI91437
UniProt: B6JAS4
Position
278519..278923
Genome map
AA seq 134 aa AA seqDB search
MSSRTDKNVSMRTPLANVRRLGAAHGGTSDFFRQRLTAVAMALLMIPVAVIVIMLVGRDQ
ASAQALLGSPVVAILLTLFIIAGCVHMKIGVQVVIEDYVHSEAAKISAILANNFFSFAVG
LASIYAIFKLSVGS
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccgcaccgacaaaaacgtttcgatgcgcacgccgctcgccaatgtgcgccgc
ctcggcgcggctcatggcggcacctccgatttcttccgccagcgcctcaccgcggttgcg
atggcgctgctgatgatcccggtcgcggtgatcgtcatcatgctggtcgggcgcgatcag
gcctcggcgcaggcgcttctcggctcacctgtcgtcgccatcctcctcacgctcttcatc
atcgccggctgcgtgcacatgaagatcggcgtgcaggtcgtgatcgaggattacgtgcac
agcgaagcggccaagatctccgcgatcctcgccaataatttcttctcgttcgctgtcggg
ctcgcctcgatctacgcgatcttcaagctgtcggtcgggagttaa

DBGET integrated database retrieval system