KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4322Help
Entry
OCAR_4322         CDS       T00783                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306631..307584
Genome map
AA seq 317 aa AA seqDB search
MEVTPTNLVLVHGALSGENRGLARAIVARVDAGGAVTQEWLEEVALLGPEPTTKHGQHGV
GALIEKLEAALEAFASLTSNMRHATSRYGETLEQQVSEMSRIEEAEYLVASLSALTRAMI
GRTRKAEEEMGKYEDEAETLRRRLENATRDAEIDYLTGLPNRRAFEVLLDRHYGEARAAA
ESLILAFCDIDHFKRVNDIHGHEAGDRVLKAIAAALSKTTDNNCHVARYGGEEFVMLFRN
ISTNEARKRFDDVRKELAEQRFINRATDRPVGQITLSGGMANVFAYSDPREALKAADDAL
FLAKERGRNQIVVAENY
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtgacgccgaccaatctggtcctggtgcatggcgcattgtcgggcgaaaatcgt
ggattggcgcgggctatcgtcgcaagggtcgacgccggtggggccgttacgcaagaatgg
cttgaagaagttgcgctccttggtcccgagccgacaacaaaacacggtcagcatggtgtc
ggcgcactgatagaaaagctcgaggcagcgctggaagcgttcgctagtttgacgagcaat
atgagacacgccacatcacgttacggcgagactcttgaacagcaagtttccgagatgtcg
aggatcgaggaggcggaatatctcgttgcaagcctctccgccctgaccagagctatgatc
ggccggactcgcaaggccgaggaggagatgggcaagtatgaagacgaggccgagaccctg
cgcaggcggctggagaacgcgacgcgagatgccgagatcgactacctgaccggacttcca
aaccgccgtgccttcgaagtgcttctggatcggcactacggggaggctcgtgcggccgcc
gaatctctaatccttgctttctgcgatatcgatcacttcaagcgggtcaatgacattcac
ggacacgaggctggagatcgggtgttgaaagcgatagctgcggcgctttcgaaaacgacg
gacaacaactgtcatgttgcgcgatatggcggtgaggaattcgtgatgttgttccgaaat
atctcaaccaatgaggcaaggaaacgattcgatgatgttcgcaaggagttggcggagcaa
cggttcatcaatcgcgcgacggacaggccggttggtcagataacgctttcaggagggatg
gctaacgtgtttgcctattccgatccccgtgaagcattaaaagctgccgacgatgccctc
tttctagcaaaagaacgtggccgcaatcagatcgtcgtcgccgaaaactattga

DBGET integrated database retrieval system