KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4322Help
Entry
OCAR_4322         CDS       T00783                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Brite
Enzymes [BR:oca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     OCAR_4322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
306631..307584
Genome map
AA seq 317 aa AA seqDB search
MEVTPTNLVLVHGALSGENRGLARAIVARVDAGGAVTQEWLEEVALLGPEPTTKHGQHGV
GALIEKLEAALEAFASLTSNMRHATSRYGETLEQQVSEMSRIEEAEYLVASLSALTRAMI
GRTRKAEEEMGKYEDEAETLRRRLENATRDAEIDYLTGLPNRRAFEVLLDRHYGEARAAA
ESLILAFCDIDHFKRVNDIHGHEAGDRVLKAIAAALSKTTDNNCHVARYGGEEFVMLFRN
ISTNEARKRFDDVRKELAEQRFINRATDRPVGQITLSGGMANVFAYSDPREALKAADDAL
FLAKERGRNQIVVAENY
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtgacgccgaccaatctggtcctggtgcatggcgcattgtcgggcgaaaatcgt
ggattggcgcgggctatcgtcgcaagggtcgacgccggtggggccgttacgcaagaatgg
cttgaagaagttgcgctccttggtcccgagccgacaacaaaacacggtcagcatggtgtc
ggcgcactgatagaaaagctcgaggcagcgctggaagcgttcgctagtttgacgagcaat
atgagacacgccacatcacgttacggcgagactcttgaacagcaagtttccgagatgtcg
aggatcgaggaggcggaatatctcgttgcaagcctctccgccctgaccagagctatgatc
ggccggactcgcaaggccgaggaggagatgggcaagtatgaagacgaggccgagaccctg
cgcaggcggctggagaacgcgacgcgagatgccgagatcgactacctgaccggacttcca
aaccgccgtgccttcgaagtgcttctggatcggcactacggggaggctcgtgcggccgcc
gaatctctaatccttgctttctgcgatatcgatcacttcaagcgggtcaatgacattcac
ggacacgaggctggagatcgggtgttgaaagcgatagctgcggcgctttcgaaaacgacg
gacaacaactgtcatgttgcgcgatatggcggtgaggaattcgtgatgttgttccgaaat
atctcaaccaatgaggcaaggaaacgattcgatgatgttcgcaaggagttggcggagcaa
cggttcatcaatcgcgcgacggacaggccggttggtcagataacgctttcaggagggatg
gctaacgtgtttgcctattccgatccccgtgaagcattaaaagctgccgacgatgccctc
tttctagcaaaagaacgtggccgcaatcagatcgtcgtcgccgaaaactattga

DBGET integrated database retrieval system