KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4478Help
Entry
OCAR_4478         CDS       T00783                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCAR_4478 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCAR_4478 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCAR_4478 (trpA)
Enzymes [BR:oca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCAR_4478 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461846..462682
Genome map
AA seq 278 aa AA seqDB search
MTTRLDTRFADLKKEGRAALVTFLMCGDPDLETSLAIMKALPKAGADVIEIGMPFTDPMA
DGPAIQAAGLRALKAGTTLKKTLDVVRNFRKGEAATPVVLMGYYNPIFIYGVDRFLVDAK
EAGVDGLIVVDLPPEEDEELCLPALKAGVNFIRLATPTTDDKRLPAVLANTSGFVYYVSI
TGITGAAAADDKQVGEAVARIKRHTQLPVCVGFGIRTPEAAARIARHCEGAVVGSALVDA
LRGTLDAEGKAGPNTVSAVTDLVAALAQGVHGVKPVSA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcgcctcgatacccgcttcgccgatctcaagaaggaaggccgcgccgcgctc
gtcaccttcctgatgtgcggcgatcccgatcttgaaacctcgctcgcgatcatgaaggcg
ctgccgaaggcgggcgccgatgtgatcgagatcggcatgccgttcaccgacccgatggcg
gatgggcctgcgattcaggcggcagggctgcgcgcgctgaaggccggcaccacgctgaag
aagacgctcgatgtcgtgcgcaacttccgcaagggtgaagcggcaacgcccgtcgtgctg
atgggctactacaatccgatcttcatctacggtgtcgatcgcttcctcgtcgatgcgaag
gaggcgggcgtcgatgggctcattgtcgtggacttgccgccggaggaagacgaggagctg
tgcctgcccgcgctcaaggccggtgtgaacttcatccggcttgcgacgccgacgaccgac
gacaagcggctgccggccgtgctcgccaacacgtcgggctttgtctattacgtctcgatc
accggcatcaccggcgccgccgcagccgacgacaagcaggtcggcgaagcggtggcgcgg
atcaagcgtcacacccaattgccggtctgcgtcggcttcggcattcgcacgcccgaggcg
gcggcccgcatcgcacgccattgcgagggcgccgtcgtcggctctgcgcttgtcgatgcg
ctgcgcggaacgctcgacgccgagggcaaggccgggccgaacacggtatccgccgtcacc
gacctggtcgctgcgctggcacagggcgtccatggcgtcaaaccagtgtcggcgtaa

DBGET integrated database retrieval system