KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4578Help
Entry
OCAR_4578         CDS       T00783                                 

Definition
lipolytic protein G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    OCAR_4578
Enzymes [BR:oca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     OCAR_4578
   3.1.2  Thioester hydrolases
    3.1.2.-  
     OCAR_4578
Lipid biosynthesis proteins [BR:oca01004]
 Fatty acid synthase
  Component type
   OCAR_4578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
569504..570097
Genome map
AA seq 197 aa AA seqDB search
MAQTFTPPLKLAVLGDSLTAGYGLPASAAFPVRLQQALKDKGIATEIVNAGVSGDTASGG
RDRLDWSIPEGTQAVLVELGANDMLRGVDPKVTRAALDDIITRLKARGIAVMLCGMYAAP
NLGEAYGRAFNSIYPELAKKHGVPLYPFFLDGVTQDAAMKLPDGLHPTAAGVDVIVARIL
PAVEAFLKELPVTSAVR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaccttcacgccgccgctcaagctcgccgtgctgggcgattccctcacggcc
ggctatgggctgccggcctctgccgcatttccggtgcggctgcagcaggcgctcaaggat
aaaggcattgcgaccgagatcgtcaacgcgggcgtatcgggtgatacggcctccggtggc
cgcgaccggctcgactggtcgatcccggagggcacacaggcggtgctggtcgaactcggc
gccaacgacatgctgcgcggggtcgatccgaaagtcacgcgcgcggccctcgacgacatc
atcacccggctgaaagcgcgcggcattgccgtgatgttgtgcggcatgtatgcggcgccc
aatctcggcgaggcgtatgggcgcgcgttcaacagtatctatcccgagctcgcgaagaag
cacggcgtgccgctctatccgttctttctcgatggcgtgacgcaggatgcagcgatgaag
ctgcctgatggcctgcatccgactgcggcgggtgtcgacgtcatcgttgcgcggatattg
cctgcggtggaggcgtttctgaaggaacttccggtcacgtccgcggtgcgttga

DBGET integrated database retrieval system