KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4583Help
Entry
OCAR_4583         CDS       T00783                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_4583 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCAR_4583 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    OCAR_4583 (sucB)
Enzymes [BR:oca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OCAR_4583 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576486..577727
Genome map
AA seq 413 aa AA seqDB search
MAEIRVPTLGESVTEATIGRWFKKTGDAVAVDEPLVELETDKVTIEVPSPSAGTLGEIVV
KDGETVAVGALLGQITEGAAKPAAAKPAEAAPAKPAAAAAAAAPAPSQKSPPADAPQAPS
VRKLSAESGIDAGTVAGSGKDGRVTKGDMLAAIEKAAASPTPINQPAASLQVRAPSPPDD
AAREERVRMTRLRQTIARRLKDVQNTAAMLTTFNEVDMSNVMALRGQYKEMFEKKHHAKL
GFMGFFVKACVQALKEIPAVNAEIDGTDIVYKNYYHVGVAVGTDKGLVVPVVRDCDRKSI
AEIETTIADLGKRARDGQLKIDEMQGGTFTLTNGGIYGSLMSTPILNAPQSAILGMHKIQ
ERPVAIGGKVEVRPMMYLALSYDHRVIDGKEAVTFLVRVKENLEDPARLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatccgcgttccgacactcggcgagtccgtcaccgaggccaccattggccgc
tggttcaagaagaccggcgacgccgttgccgtcgacgagccgctcgtcgaactggagacg
gacaaggtgacgatcgaggtgccctcgccatccgccggcacgctcggcgaaatcgtcgtc
aaggatggcgagacggtcgccgttggcgcgctgctcggccagatcaccgaaggtgcggcc
aagcctgccgcggcgaagcccgcagaggcggcgccggcgaagcctgctgcggctgcggcc
gccgctgctccggctccctcacaaaaatcgccgccggctgatgcgccgcaggcgccctcc
gtacgcaagctgtcagccgagagcggcatcgatgccgggactgttgccggcagcggcaag
gatggccgcgtcaccaagggcgacatgctagccgcaatcgagaaggcagcggcctccccg
acgccgatcaaccagcctgccgcctcgctgcaggtgcgcgcgccttcgccgccggatgat
gccgcgcgcgaggagcgggtgcggatgacgcgactgcgccagaccatcgcccgccgcctc
aaggacgtgcagaacaccgccgcgatgctgacgaccttcaacgaggtcgacatgtcgaac
gtcatggccctgcgtggccaatacaaggagatgttcgagaagaagcaccacgcgaagctt
ggcttcatgggcttcttcgtgaaggcttgcgtgcaggcgctgaaggaaattccggcagtg
aacgccgagatcgacggcaccgatatcgtctacaagaactattatcatgtcggcgtcgcc
gtcggcaccgacaagggcctcgtggtgccggtggtgcgcgattgcgatcgcaaatcgatc
gccgagatcgaaaccaccattgccgatctgggcaagcgcgcgcgcgacggtcaactcaag
atcgacgagatgcagggcggcaccttcaccctgaccaatggcggcatttatggctcgctg
atgtcgactccgatcctcaacgcgccgcagtccgccattctcggcatgcacaagattcag
gagcgcccggtcgcgatcggcggcaaggtcgaggtgcggccgatgatgtatctcgcactg
tcctacgatcaccgcgtcatcgacggcaaggaagcggtgaccttcctcgtccgcgtcaag
gagaacctcgaggacccggcgcggctcgtgctcgacctgtaa

DBGET integrated database retrieval system