KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4621Help
Entry
OCAR_4621         CDS       T00783                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:oca00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:oca00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
612728..613294
Genome map
AA seq 188 aa AA seqDB search
MKFNPSPLRGACTIELEKRGDDRGFFARMFCEREFADAGLETRFVQVNNSLTAKRGTLRG
LHYQLPPAAEVKVVRCVRGALYDVIVDLRPDSPTFRKWFGAELTADNRTMMYVPRGFAHA
FLTLTDDAEAMYLVSAFYSPENERGVRYNDPAFSIAWPVDPLEVSDKDRNWPDFNADFHG
TERMRNLA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaatccgagcccgcttcggggcgcatgcacgattgagctggaaaagcgtggg
gacgatcgcggcttcttcgcgcgaatgttctgtgagcgcgagttcgcagacgccgggctt
gagacgcgttttgtgcaggtcaataattctctgacggccaagcggggcacgctgcgcgga
ttgcattatcagttgccgccagcggccgaggtgaaggtcgtccgttgcgtgcgcggcgcg
ctatacgatgtgatcgttgatttgcggcctgactcgccgactttccgtaagtggtttggg
gcagagctcaccgccgacaatcgcacgatgatgtacgtgccgcgcgggttcgcccatgcg
ttcctgacgctgacggatgacgcggaggcgatgtatctcgtcagtgctttctattcgccg
gaaaacgagcgtggtgtgcgctataacgatcccgcgttttcaatcgcgtggccggtcgat
ccgctggaagtctccgacaaagaccgcaattggcccgacttcaatgctgattttcacggc
accgagcggatgcggaatctggcatga

DBGET integrated database retrieval system