KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4686Help
Entry
OCAR_4686         CDS       T00783                                 

Gene name
ctaD
Definition
cytochrome c oxidase subunit I (EC:1.9.3.1)
Orthology
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    OCAR_4686 (ctaD)
Enzymes [BR:oca01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     OCAR_4686 (ctaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675606..677231
Genome map
AA seq 541 aa AA seqDB search
MATSAATSAHTDHAHDDHAHDHPTGWRRYLFSTNHKDIGTMYLIFAVVAGLIGGAMSVAI
RIELMYPGVQLFHEAHTFNVFVSNHGLIMIFFALMPALIGGFGNWFVPLMIGAPDMAFPR
MNNISFWLLPSSFALLILSAFVEGEPGSLGAGTGWTMYAPLSTSGHPGPAVDFVILSMHI
AGASSILGAINFITTIFNMRAPGMTMHKMPLFVWSVLVTAFMLLLSLPVLAGGITMLLTD
RNFGTAFFAADGGGDPVLYQHLFWFFGHPEVYIMILPGFGIISHVTSTFSRKPIFGYLGM
VYAMVAIGGIGFVVWAHHMYTVGMSASAQAYFVAASMVIAVPTGVKIFSWIATMWGGSIE
FKAPMLWAIGFIFLFTVGGVTGVVLANAGVDRVLQDTYYVIAHFHYVLSLGAVFAIFAGW
YYWFPKMFGYMYNETIAKAHFWLMFIGVNVLFFPMHFLGLSGMPRRYVDYPDAFAGWNLV
ASIGSYISAFGVLVFLYGVVEAFARKIPAPNNPWGPGATTLEWTLTSPPPFHQFEVLPRI
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtccgctgcaacttccgcccacaccgatcacgctcatgatgatcatgcgcac
gatcatccgaccgggtggcggcggtatctcttctccacgaaccataaggacatcggcacg
atgtaccttatcttcgcggtggtcgctggcctgatcggcggcgcgatgtcggtcgcgatc
cgcatcgagttgatgtatcccggcgtgcagttgttccatgaggcccacacgttcaacgtg
ttcgtgtccaatcacggcctcatcatgatcttcttcgcgctgatgcccgctctgatcggc
ggcttcggcaactggttcgtgccgctgatgatcggtgcgccggacatggcgttcccgcgc
atgaacaacatttcgttctggctgctgccctcgtccttcgcgctcctcatcctctcggcg
ttcgtcgagggcgagccgggctcgctcggcgcaggtacgggctggaccatgtacgcgccg
ctgtcgacgtccggccatcctggaccggcggtcgacttcgtcattctctcgatgcacatc
gccggcgcgtcgtcgattctcggcgcgatcaacttcatcaccacgatcttcaacatgcgc
gcgcctggcatgaccatgcacaagatgccgctgttcgtgtggtcggtgctggtgacggcg
ttcatgttgctgctgtcgctgccggtgctcgccggtggcatcaccatgctgctgaccgac
cgcaacttcggcaccgcgttcttcgcggccgacggcggcggtgacccggtgctctaccag
catctgttctggttcttcggccaccccgaagtttacatcatgatcctgccgggcttcggc
atcatcagccacgtcacctcgaccttcagccgcaagccgatcttcggttatctcggcatg
gtctacgccatggtcgcgatcggcggcatcggcttcgtggtctgggcccaccacatgtac
accgtgggcatgtcggcgtcggcgcaggcctatttcgtcgcggcgagcatggtcatcgcg
gtgccgaccggcgtgaagatcttctcctggatcgccacgatgtggggcggctccatcgag
ttcaaggcgccgatgctgtgggcgatcggcttcatcttcctgttcacggtcggtggtgtg
acgggcgtcgtgctcgcgaacgccggcgtcgaccgcgttctccaggacacctactacgtg
attgcgcacttccactacgtgctgtcgctcggcgccgtgttcgcaatcttcgccggctgg
tactactggttcccgaagatgttcggttacatgtacaatgagaccatcgccaaggcgcat
ttctggctgatgtttatcggcgtgaacgtgctgttcttcccgatgcacttcctcggtttg
tcgggcatgccgcgccgctatgtcgactatccggatgcctttgccggctggaacctggtc
gcttcgatcggctcctacatctcggccttcggcgtgctggtcttcctctatggtgtcgtc
gaagccttcgcacgcaagattccggccccgaacaatccgtggggtcccggtgcgaccacg
ctggaatggacgctgacttcgcctccgccgttccaccagttcgaggttctgcctcgcatt
cggtaa

DBGET integrated database retrieval system