KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4709Help
Entry
OCAR_4709         CDS       T00783                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OCAR_4709
Enzymes [BR:oca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OCAR_4709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697874..698674
Genome map
AA seq 266 aa AA seqDB search
MDVKTDDKLNLRAKEYFDERATKEMAEHLKGAQRSPKEKLAYACRILAMTEQEAGLAGQI
SLRSERPNAYWTLRFGLGFDEATPDDFIEVDRDLNTLTGTGMPNPATRFHLWVYEARPDV
QSMIHTHSPWASALAAARQPLVISQMDMTPLHDDCAFLGDWPGVPIADQEGVLISAALGS
KRAIILAHHGYLTAGCSIEEATYLSVYLERAARMQIRARVFGPLTPVDPELAKEAHDYLL
KPSIVNATFDYWCRQTHQANLAPTPR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgaagacagacgacaagctcaacctgcgcgccaaggaatatttcgacgagcgc
gccaccaaggaaatggcggagcatctgaaaggcgcccagcgcagcccgaaggaaaagctc
gcctatgcctgccgcatcctggcgatgactgaacaggaagcgggcctcgccggccagatc
agcctgcgctccgagcggccgaatgcctactggacgctacgctttggccttggcttcgac
gaagcgacgccggacgatttcatcgaggtcgaccgcgacctgaacacgctgaccggcact
ggcatgccgaaccctgcgacccgttttcacctctgggtatatgaagcgcgcccggatgtg
cagtcgatgatccacactcactcgccgtgggcctcggcgctcgccgccgcgcgccagccg
ctggtgatctcgcagatggacatgacgccgctgcatgacgactgcgcgttcctcggcgac
tggccgggcgtgccgatcgccgatcaggagggtgtgctgatttccgcggcgctcggctcc
aagcgcgcgatcatccttgctcaccatggctatctgactgcgggctgctcgatcgaggaa
gcgacctatctgtcggtctatctcgaacgtgccgcgcgcatgcagattcgcgcccgcgtg
ttcggcccgctgacgccggtcgatcccgagctcgccaaggaagcgcacgactatctgctc
aagccctcgatcgtgaacgccacgttcgattactggtgccggcagacgcatcaggcaaat
ctggcgccgaccccgcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system