KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4934Help
Entry
OCAR_4934         CDS       T00783                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OCAR_4934 (galU)
   00052 Galactose metabolism
    OCAR_4934 (galU)
   00500 Starch and sucrose metabolism
    OCAR_4934 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    OCAR_4934 (galU)
Enzymes [BR:oca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OCAR_4934 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(905740..906666)
Genome map
AA seq 308 aa AA seqDB search
MPSKTSPSKTSPSKRSRLMKIRKAVFPVAGLGTRFLPATKAMPKEMLTVVDRPLIQHVVD
EALEAGIEHLVFVTGRNKGVIEDHFDRPYELEDTLKERNKLKEMDILERDQPEAGATSFT
RQQAPLGLGHAVWCARDIIGNEPFAVLLPDVLVKHKPSGLKQMIDAAAAAGASSANIIAV
EEVPMEHVHMYGVVGVGPSKGDLFELNGMVEKPKKEVAPSNLSITGRYILQPEIFNILET
QERGAGGEIQLTDAMLALAGKQPFYGFKFKGKSYDCGSKSGFLAANIAYAMDREDLRGDL
LSEMKKYV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgccctccaagacctcgccatccaagacctcgccatccaagagaagccgcctcatgaaa
atccgcaaagccgtatttcccgtcgccggcctcggcacccgtttccttcccgccaccaag
gcgatgccgaaggagatgctgaccgtggtggaccgcccgctgattcagcatgtggtggac
gaagcgctggaggccggcatcgagcacctcgtgttcgtcaccgggcgcaacaagggcgtg
atcgaggatcacttcgaccgcccctacgagctcgaggacacgctgaaggagcgcaacaag
ctcaaggaaatggacatcctcgagcgcgaccagccggaagccggcgcgacctcgttcacg
cgccagcaggcgccgctcggcctcggccatgcggtgtggtgcgcgcgcgacatcatcggc
aacgagccgttcgccgtgctgctgcccgacgtgctggtgaagcacaagccgagcggcctg
aagcagatgatcgatgcggccgccgccgcgggcgcctccagcgccaacatcatcgcggtg
gaagaagtgccgatggagcacgtccacatgtacggcgtcgtcggcgtcggcccgtcgaag
ggcgacctgttcgaactgaacggcatggtcgagaagccgaagaaggaagtcgcgccctcg
aacctctcgatcaccgggcgctacatcctgcagccggagatcttcaatatcctcgagacg
caggagcgcggcgcgggcggcgaaatccagcttaccgacgcgatgctcgcgcttgcggga
aagcagccgttctacggattcaagttcaagggcaagagctacgactgcggatcgaagtca
ggatttttggccgccaacatcgcctacgccatggaccgcgaagacctgcgcggcgatttg
ctcagcgagatgaagaagtatgtgtga

DBGET integrated database retrieval system