KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4944Help
Entry
OCAR_4944         CDS       T00783                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:oca00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920931..921875
Genome map
AA seq 314 aa AA seqDB search
MTLVSIPANPVPEDVVSGTIKARDGVELRFARWAPPAGRKGTVCIFAGRGECIEKYFETV
HELRSRGFAVAMADWRGQGHSGRQLGDYRKGYVRSFKDYEADVATFVQQVMLPDCPPPYF
ALAHSMGGAVLLRVLHGGARWFDRIVMTAPMIDLPGRTTSWPVRTLIRTLRFVGMGGSYV
PGGNDRLVGSAPFADNPLTSDPVRYARNAAILEEEPTLGIASPTIAWTDAAFRTILSFRA
ASYPSRIRQPVLLLAAGHDRVVSTPAIEEFAYHLRAGSHLVIAGARHEILQEQDRYRAQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggtttcgatccccgccaatcccgtgcccgaagatgtcgtctccggcaccatc
aaggcccgcgatggggtggagctgcgctttgcgcgctgggcgccgcccgcgggccgcaag
ggcacggtctgcatctttgccgggcgcggcgagtgcatcgagaaatatttcgagacggta
catgaactgcgttcgcgcggctttgcagttgcgatggccgactggcgcgggcaggggcat
tccgggcggcagcttggcgattaccgcaagggttatgtccgcagcttcaaggattacgag
gccgacgtcgcgaccttcgtccagcaggtgatgctgccggattgcccgccgccttacttc
gcgctcgcccattcgatgggcggtgcggtgctgctgcgggtgctgcatggcggcgcgcgc
tggttcgaccgcatcgtcatgaccgcgccgatgatcgacctgccgggacgcaccacctcg
tggccggtgcgcacgctgatccgcaccctgcggttcgtcggtatgggcggcagttatgtg
cccggcggcaatgaccggctggtcggcagcgcaccgttcgcggacaatccgctgaccagc
gatccggtgcgctatgcgcgcaatgccgcgatcctggaagaagagccgacgctcggcatc
gcctcgccgaccattgcgtggaccgacgccgcattccgcaccatcctgagttttcgcgcg
gcgagttatccttcgcgcatccgccagcctgtgttgttacttgcggcgggccatgaccgc
gtggtctcgacgcccgcgatcgaggagtttgcctaccacctgcgcgcgggctcgcacctg
gttatcgctggcgcgcgccacgagatcctgcaggagcaggaccgttaccgggcgcagttc
tgggccgccttcgacgcgttcgtgcccggcacgccgttgttctag

DBGET integrated database retrieval system