KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_4944Help
Entry
OCAR_4944         CDS       T00783                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    OCAR_4944
Enzymes [BR:oca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     OCAR_4944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920931..921875
Genome map
AA seq 314 aa AA seqDB search
MTLVSIPANPVPEDVVSGTIKARDGVELRFARWAPPAGRKGTVCIFAGRGECIEKYFETV
HELRSRGFAVAMADWRGQGHSGRQLGDYRKGYVRSFKDYEADVATFVQQVMLPDCPPPYF
ALAHSMGGAVLLRVLHGGARWFDRIVMTAPMIDLPGRTTSWPVRTLIRTLRFVGMGGSYV
PGGNDRLVGSAPFADNPLTSDPVRYARNAAILEEEPTLGIASPTIAWTDAAFRTILSFRA
ASYPSRIRQPVLLLAAGHDRVVSTPAIEEFAYHLRAGSHLVIAGARHEILQEQDRYRAQF
WAAFDAFVPGTPLF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggtttcgatccccgccaatcccgtgcccgaagatgtcgtctccggcaccatc
aaggcccgcgatggggtggagctgcgctttgcgcgctgggcgccgcccgcgggccgcaag
ggcacggtctgcatctttgccgggcgcggcgagtgcatcgagaaatatttcgagacggta
catgaactgcgttcgcgcggctttgcagttgcgatggccgactggcgcgggcaggggcat
tccgggcggcagcttggcgattaccgcaagggttatgtccgcagcttcaaggattacgag
gccgacgtcgcgaccttcgtccagcaggtgatgctgccggattgcccgccgccttacttc
gcgctcgcccattcgatgggcggtgcggtgctgctgcgggtgctgcatggcggcgcgcgc
tggttcgaccgcatcgtcatgaccgcgccgatgatcgacctgccgggacgcaccacctcg
tggccggtgcgcacgctgatccgcaccctgcggttcgtcggtatgggcggcagttatgtg
cccggcggcaatgaccggctggtcggcagcgcaccgttcgcggacaatccgctgaccagc
gatccggtgcgctatgcgcgcaatgccgcgatcctggaagaagagccgacgctcggcatc
gcctcgccgaccattgcgtggaccgacgccgcattccgcaccatcctgagttttcgcgcg
gcgagttatccttcgcgcatccgccagcctgtgttgttacttgcggcgggccatgaccgc
gtggtctcgacgcccgcgatcgaggagtttgcctaccacctgcgcgcgggctcgcacctg
gttatcgctggcgcgcgccacgagatcctgcaggagcaggaccgttaccgggcgcagttc
tgggccgccttcgacgcgttcgtgcccggcacgccgttgttctag

DBGET integrated database retrieval system