KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5004Help
Entry
OCAR_5004         CDS       T00783                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:oca00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975352..976119
Genome map
AA seq 255 aa AA seqDB search
MVKSVTYTALPGLPLVEPGDDLGNIIAEGVRRAEIVVADGDIFVIAQKIVSKAENRYVDL
NEIVPSAQALELAKTVGKDPRHIEVVLSESTEVVRFRQNVMIVAHRLGFVMANAGIDESN
IAHDDGKARVLLLPKDPDASGEMLRQQLQRTFGVKIGVIINDSFGRPWRNGVVGVAIGSA
GIPSLQSMIGAPDLFNRAMRVTEIAIADELAAAASLVMGQAAEGLPVVHIRGFHSEAAHS
PASVLARPKAQDMFR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagagcgtcacatacactgcgcttcccggattgccgttggttgagcccggagac
gaccttggcaacatcattgccgagggcgtgcgacgtgctgagattgtcgtggccgatggc
gatatcttcgtgatcgcgcagaagatcgtttccaaggccgagaaccgttacgttgacctg
aatgagattgtgccgtctgcacaggcgctggagcttgcgaagacagtcggcaaagatcct
cgtcatatcgaagtcgttctttcggaatcgaccgaggtggtgcgtttccgccagaacgtg
atgatcgtagctcatcggctcggctttgttatggccaatgccggcatcgacgaatccaat
attgcccatgacgatggaaaggcacgcgttctgctgctgccgaaagacccggatgcaagc
ggtgagatgctccggcagcaactgcagcggacgtttggcgtcaagatcggtgttattatc
aatgacagcttcggccgcccatggcgaaatggggtggttggggtcgcgattggaagcgcg
ggcattccgtcattgcaaagcatgatcggcgcgcccgatctgtttaatcgtgccatgcgt
gtcaccgagattgcgatagctgatgaattggccgccgccgcttcattggtgatgggacag
gccgctgaagggctgccagtcgttcacatccgcggttttcacagtgaagccgcgcactct
ccggcttcggtgctggcacggccgaaggcgcaggatatgttccgatga

DBGET integrated database retrieval system