KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5067Help
Entry
OCAR_5067         CDS       T00783                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00030  Pentose phosphate pathway
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01120  Microbial metabolism in diverse environments
oca01130  Biosynthesis of antibiotics
oca01200  Carbon metabolism
Module
oca_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OCAR_5067 (pgl)
Enzymes [BR:oca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     OCAR_5067 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: ACI92202
UniProt: B6JBY6
Position
complement(1038052..1038789)
Genome map
AA seq 245 aa AA seqDB search
MGRPHVIVEADTAALAGRAAQRLVARVTENNGLCAICLTGGSTPKRLYELLATPEWRARL
PWERIHWFIGDDRFVPENDPLSNIGMARLAFLDACAPPETIHPIPTDTASPDEAARLYEA
TLRDFQAHARTSDAPLFDLVLLGVGPDGHIASLFPGYPAATETQRWVVGVPKANVAPFVP
RVSLTLPCLAQCREMLLMASGAEKRAILTRVFAGEDLPAAHASSKRGDTIWLIDKAAAPD
IGEAP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggacggccgcacgtcatcgtcgaggcagatacggctgcattggcgggccgcgcggcg
cagcgtctcgtcgcacgagtgacggagaacaatggcctctgtgcgatctgccttaccggc
ggttcgacgccgaagcggctgtatgaattgctggcaacaccggaatggcgcgcgcggctg
ccatgggagcgcattcactggttcatcggcgacgaccgtttcgtgccggagaatgatccg
ctcagcaatatcggcatggcgcgccttgcgtttctcgatgcctgcgcaccgccagagacg
atccatccgattccaaccgatacggcctcgccggacgaagccgcgcgcctttacgaggca
acgcttcgtgattttcaggcccatgcccgcaccagcgatgctccgctattcgatctcgtg
ctgctcggcgtcggcccggatgggcacatcgcctcgctgttccccggctaccctgcagcc
accgagacccagcgctgggtcgtcggcgtaccgaaagcgaacgttgcgccgttcgtgccg
cgcgtcagcctcacactgccttgtctcgcacaatgccgcgaaatgctgctgatggcgtcg
ggcgcggagaagcgtgcaatcctcacacgtgtgttcgcgggcgaagacctgccggccgcg
cacgcctcgtccaagcgtggcgacacgatctggctgatcgacaaggccgcggcgcccgac
attggcgaggcgccatga

DBGET integrated database retrieval system