KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5067Help
Entry
OCAR_5067         CDS       T00783                                 

Gene name
pgl
Definition
6-phosphogluconolactonase (EC:3.1.1.31)
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_5067 (pgl)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OCAR_5067 (pgl)
Enzymes [BR:oca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     OCAR_5067 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1038052..1038789)
Genome map
AA seq 245 aa AA seqDB search
MGRPHVIVEADTAALAGRAAQRLVARVTENNGLCAICLTGGSTPKRLYELLATPEWRARL
PWERIHWFIGDDRFVPENDPLSNIGMARLAFLDACAPPETIHPIPTDTASPDEAARLYEA
TLRDFQAHARTSDAPLFDLVLLGVGPDGHIASLFPGYPAATETQRWVVGVPKANVAPFVP
RVSLTLPCLAQCREMLLMASGAEKRAILTRVFAGEDLPAAHASSKRGDTIWLIDKAAAPD
IGEAP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggacggccgcacgtcatcgtcgaggcagatacggctgcattggcgggccgcgcggcg
cagcgtctcgtcgcacgagtgacggagaacaatggcctctgtgcgatctgccttaccggc
ggttcgacgccgaagcggctgtatgaattgctggcaacaccggaatggcgcgcgcggctg
ccatgggagcgcattcactggttcatcggcgacgaccgtttcgtgccggagaatgatccg
ctcagcaatatcggcatggcgcgccttgcgtttctcgatgcctgcgcaccgccagagacg
atccatccgattccaaccgatacggcctcgccggacgaagccgcgcgcctttacgaggca
acgcttcgtgattttcaggcccatgcccgcaccagcgatgctccgctattcgatctcgtg
ctgctcggcgtcggcccggatgggcacatcgcctcgctgttccccggctaccctgcagcc
accgagacccagcgctgggtcgtcggcgtaccgaaagcgaacgttgcgccgttcgtgccg
cgcgtcagcctcacactgccttgtctcgcacaatgccgcgaaatgctgctgatggcgtcg
ggcgcggagaagcgtgcaatcctcacacgtgtgttcgcgggcgaagacctgccggccgcg
cacgcctcgtccaagcgtggcgacacgatctggctgatcgacaaggccgcggcgcccgac
attggcgaggcgccatga

DBGET integrated database retrieval system