KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5223Help
Entry
OCAR_5223         CDS       T00783                                 

Definition
(GenBank) fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00071  Fatty acid degradation
oca00280  Valine, leucine and isoleucine degradation
oca00281  Geraniol degradation
oca00310  Lysine degradation
oca00362  Benzoate degradation
oca00380  Tryptophan metabolism
oca00410  beta-Alanine metabolism
oca00640  Propanoate metabolism
oca00650  Butanoate metabolism
oca00903  Limonene and pinene degradation
oca00930  Caprolactam degradation
oca01040  Biosynthesis of unsaturated fatty acids
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01120  Microbial metabolism in diverse environments
oca01130  Biosynthesis of antibiotics
oca01200  Carbon metabolism
oca01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCAR_5223
   00650 Butanoate metabolism
    OCAR_5223
  Lipid metabolism
   00071 Fatty acid degradation
    OCAR_5223
   01040 Biosynthesis of unsaturated fatty acids
    OCAR_5223
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCAR_5223
   00310 Lysine degradation
    OCAR_5223
   00380 Tryptophan metabolism
    OCAR_5223
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCAR_5223
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCAR_5223
   00281 Geraniol degradation
    OCAR_5223
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCAR_5223
   00930 Caprolactam degradation
    OCAR_5223
Enzymes [BR:oca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     OCAR_5223
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCAR_5223
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     OCAR_5223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA Methyltransf_31 NAD_Gly3P_dh_N Sacchrp_dh_NADP Pyr_redox_2 AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACI92355
UniProt: B6JCD9
Position
1196789..1198870
Genome map
AA seq 693 aa AA seqDB search
MDSKILNAMKDHVLELGPEPSSGPYRHFKLTRDEDGIAWLLFDREGASANTLSSEVLEEF
SQILSVLESERPSGLVLRSAKRSGFIAGADINEFRGLSDVSIVEQQLGHGHDILNRLENI
KLPTVAVIHGFCLGGGLEVVLACNMRIAIEGARFGFPEILLGLHPGFGGTARATHLFNPL
EAMTMMLTGKTVEARKAKALGLVDAVTQERHVRNAVKDAIFGRLKRKRLKLTTLMNLGPA
RKLLASRMRKEAANKAPQENYPAPYALIDLWEKHGGNRADMLAAEKPSFAKLMVTSTAQN
LIRVFFLRDEMKKLAGGKSKIRHVHVIGAGAMGGDIASWCAHQGLRVTLADMQPAAIANA
MKRAADLFAKIARGRIAQRDTLDRLIPDMTGEGAKQADLIIEAVPEKLQLKQSIYAGLEK
VMRPDAILATNTSSIPLEELRASLQRPERLLGIHFFNPVSRLQLVEVISHDQVDQEALAT
AMKFVGGIDRLPLPVKSSPGFLVNRALMPYLMEALLMLDEKVDKLTIDEAAEKFGMPMGP
IELADQVGLDICLAVGDELRAKLGDSIPVAPDWLRDKVAKGELGRKTGRGFYEWKDGRVQ
KGHAHVHATPEMTDRLVLPMSNVCVACLREGIVDNPDTVDGAMIFGTGYAPFRGGPLNYA
RERGPENVANALLVLAEKYGERFKPDAGWATFR
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaaatcctcaatgcgatgaaggaccacgtccttgaactcgggcctgagccg
tcgtccggaccttatcgccatttcaagttgacgcgcgacgaagacggaatcgcctggctg
ctgttcgaccgcgaaggcgcaagcgccaacacgttgtcgagcgaggtgctggaagaattc
tcgcagatcctctcggtgctggagagcgagcgcccgagcgggcttgtgctgcgctcggcc
aagcgctccggcttcatcgcgggtgcggacatcaatgaattccgcggtctctccgatgtc
agcatcgtcgagcagcagcttggtcacgggcatgacattctcaaccggcttgagaacatc
aagctgccgacggtcgcggtaatccacggcttctgcctcggcggcgggcttgaggtcgtg
ctcgcctgcaacatgcggatcgcgatcgaaggcgcacgcttcggattcccggaaatattg
ctcggcctgcatccgggctttggcggcacggcgcgcgcaacgcatctgttcaatccgctc
gaagcgatgaccatgatgctgacgggcaagaccgtcgaggcgcgcaaagcgaaggcgctc
ggccttgtcgatgctgtgacgcaggagcgccacgttcgcaatgcagtgaaggatgcgatc
ttcggtcgcctgaagcgcaagcgcttgaagctgacgacgttgatgaaccttggtccggcc
cgcaagctgctggcttcgcgcatgcgtaaggaggctgccaataaagcgccacaggagaat
taccccgcgccctacgcgctgatcgatctgtgggagaagcacggcggcaaccgcgccgac
atgctggcggcggagaagccgtccttcgccaaactgatggtgacgtcgaccgcgcagaat
ctcattcgtgtgttcttcctgcgcgacgagatgaagaagctcgcgggcggcaagagcaag
atcaggcatgtccatgtgatcggcgccggtgcgatgggcggcgacattgcgtcgtggtgc
gcgcatcagggcctgcgcgtgacgcttgccgacatgcagccggcggcgattgcgaatgcg
atgaagcgcgcggcagatctgtttgcgaagatcgcccgcggccgcattgcccagcgcgac
acgcttgatcgtttgattccggacatgacgggagaaggcgcaaagcaggcggatctcatc
atcgaggccgtgccggagaagttgcagctcaagcaatcgatttatgccggccttgaaaaa
gtgatgcggccggacgccatcctcgcgaccaacacgtccagcattccgctcgaggagttg
cgcgcctcgctgcagcggccggagcgattgctcggcatccatttcttcaatccggtgtcg
cggctgcaactggttgaagtgatcagccacgatcaggtcgatcaggaggcgcttgcgacc
gcgatgaagttcgtcggtggaatcgatcgcctgccgctgccggtgaagagttcgccgggc
ttcctcgtcaaccgcgcgctgatgccgtatctgatggaagcgctgctgatgctcgacgag
aaggtggacaaactcaccatcgacgaggcggcggaaaagttcggcatgccgatgggcccg
atcgaactcgccgatcaggtcggcctcgatatctgtcttgcggtcggcgatgagttgcgc
gccaagcttggcgattccattccggttgcgcctgactggttgcgcgacaaggtcgcgaag
ggcgaactcggtcgcaagaccggacgcggattctacgaatggaaggacggccgcgtgcag
aagggccatgcccatgttcacgccacgccggaaatgaccgatcgccttgtgctgccgatg
tcgaacgtctgcgtcgcctgtttgcgtgaaggcatcgtcgacaatcccgatacggtggac
ggcgcgatgatcttcggcaccggctatgcgccgttccgcggcgggccgctcaactacgca
cgcgagcgtgggccggagaatgtcgccaacgcgctcttggtgctggcggagaaatacggt
gagcgcttcaagccggatgccggctgggcgacgtttcgctga

DBGET integrated database retrieval system