KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5223Help
Entry
OCAR_5223         CDS       T00783                                 

Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_5223
   01212 Fatty acid metabolism
    OCAR_5223
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCAR_5223
   00650 Butanoate metabolism
    OCAR_5223
  Lipid metabolism
   00071 Fatty acid degradation
    OCAR_5223
   01040 Biosynthesis of unsaturated fatty acids
    OCAR_5223
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCAR_5223
   00310 Lysine degradation
    OCAR_5223
   00380 Tryptophan metabolism
    OCAR_5223
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCAR_5223
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCAR_5223
   00281 Geraniol degradation
    OCAR_5223
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    OCAR_5223
Enzymes [BR:oca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     OCAR_5223
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCAR_5223
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     OCAR_5223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1196789..1198870
Genome map
AA seq 693 aa AA seqDB search
MDSKILNAMKDHVLELGPEPSSGPYRHFKLTRDEDGIAWLLFDREGASANTLSSEVLEEF
SQILSVLESERPSGLVLRSAKRSGFIAGADINEFRGLSDVSIVEQQLGHGHDILNRLENI
KLPTVAVIHGFCLGGGLEVVLACNMRIAIEGARFGFPEILLGLHPGFGGTARATHLFNPL
EAMTMMLTGKTVEARKAKALGLVDAVTQERHVRNAVKDAIFGRLKRKRLKLTTLMNLGPA
RKLLASRMRKEAANKAPQENYPAPYALIDLWEKHGGNRADMLAAEKPSFAKLMVTSTAQN
LIRVFFLRDEMKKLAGGKSKIRHVHVIGAGAMGGDIASWCAHQGLRVTLADMQPAAIANA
MKRAADLFAKIARGRIAQRDTLDRLIPDMTGEGAKQADLIIEAVPEKLQLKQSIYAGLEK
VMRPDAILATNTSSIPLEELRASLQRPERLLGIHFFNPVSRLQLVEVISHDQVDQEALAT
AMKFVGGIDRLPLPVKSSPGFLVNRALMPYLMEALLMLDEKVDKLTIDEAAEKFGMPMGP
IELADQVGLDICLAVGDELRAKLGDSIPVAPDWLRDKVAKGELGRKTGRGFYEWKDGRVQ
KGHAHVHATPEMTDRLVLPMSNVCVACLREGIVDNPDTVDGAMIFGTGYAPFRGGPLNYA
RERGPENVANALLVLAEKYGERFKPDAGWATFR
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaaaatcctcaatgcgatgaaggaccacgtccttgaactcgggcctgagccg
tcgtccggaccttatcgccatttcaagttgacgcgcgacgaagacggaatcgcctggctg
ctgttcgaccgcgaaggcgcaagcgccaacacgttgtcgagcgaggtgctggaagaattc
tcgcagatcctctcggtgctggagagcgagcgcccgagcgggcttgtgctgcgctcggcc
aagcgctccggcttcatcgcgggtgcggacatcaatgaattccgcggtctctccgatgtc
agcatcgtcgagcagcagcttggtcacgggcatgacattctcaaccggcttgagaacatc
aagctgccgacggtcgcggtaatccacggcttctgcctcggcggcgggcttgaggtcgtg
ctcgcctgcaacatgcggatcgcgatcgaaggcgcacgcttcggattcccggaaatattg
ctcggcctgcatccgggctttggcggcacggcgcgcgcaacgcatctgttcaatccgctc
gaagcgatgaccatgatgctgacgggcaagaccgtcgaggcgcgcaaagcgaaggcgctc
ggccttgtcgatgctgtgacgcaggagcgccacgttcgcaatgcagtgaaggatgcgatc
ttcggtcgcctgaagcgcaagcgcttgaagctgacgacgttgatgaaccttggtccggcc
cgcaagctgctggcttcgcgcatgcgtaaggaggctgccaataaagcgccacaggagaat
taccccgcgccctacgcgctgatcgatctgtgggagaagcacggcggcaaccgcgccgac
atgctggcggcggagaagccgtccttcgccaaactgatggtgacgtcgaccgcgcagaat
ctcattcgtgtgttcttcctgcgcgacgagatgaagaagctcgcgggcggcaagagcaag
atcaggcatgtccatgtgatcggcgccggtgcgatgggcggcgacattgcgtcgtggtgc
gcgcatcagggcctgcgcgtgacgcttgccgacatgcagccggcggcgattgcgaatgcg
atgaagcgcgcggcagatctgtttgcgaagatcgcccgcggccgcattgcccagcgcgac
acgcttgatcgtttgattccggacatgacgggagaaggcgcaaagcaggcggatctcatc
atcgaggccgtgccggagaagttgcagctcaagcaatcgatttatgccggccttgaaaaa
gtgatgcggccggacgccatcctcgcgaccaacacgtccagcattccgctcgaggagttg
cgcgcctcgctgcagcggccggagcgattgctcggcatccatttcttcaatccggtgtcg
cggctgcaactggttgaagtgatcagccacgatcaggtcgatcaggaggcgcttgcgacc
gcgatgaagttcgtcggtggaatcgatcgcctgccgctgccggtgaagagttcgccgggc
ttcctcgtcaaccgcgcgctgatgccgtatctgatggaagcgctgctgatgctcgacgag
aaggtggacaaactcaccatcgacgaggcggcggaaaagttcggcatgccgatgggcccg
atcgaactcgccgatcaggtcggcctcgatatctgtcttgcggtcggcgatgagttgcgc
gccaagcttggcgattccattccggttgcgcctgactggttgcgcgacaaggtcgcgaag
ggcgaactcggtcgcaagaccggacgcggattctacgaatggaaggacggccgcgtgcag
aagggccatgcccatgttcacgccacgccggaaatgaccgatcgccttgtgctgccgatg
tcgaacgtctgcgtcgcctgtttgcgtgaaggcatcgtcgacaatcccgatacggtggac
ggcgcgatgatcttcggcaccggctatgcgccgttccgcggcgggccgctcaactacgca
cgcgagcgtgggccggagaatgtcgccaacgcgctcttggtgctggcggagaaatacggt
gagcgcttcaagccggatgccggctgggcgacgtttcgctga

DBGET integrated database retrieval system