KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5237Help
Entry
OCAR_5237         CDS       T00783                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:oca00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:oca00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1212113..1213555
Genome map
AA seq 480 aa AA seqDB search
MKLRDLLRGEAAIDPQAAELAVAGVAVDSRAVKPGDVFFALGGHKTDGARFIEAAVKAGA
VAVVTGHPHTASVPVVVADDPRRALALAAAVVYPRQPRTIAAVTGTSGKTSVAAFTRQVW
DSLGHNAASLGTIGIVSRHRNVYGSLTTPDPVALHRAIDELAGDGVTHLALEASSHGLDQ
HRLDGVRITATAFTNLSRDHMDYHPTVEHYLATKLRLFTDLAPEGAPAVIAADHEHSATV
IAAARTHKLNVMTVGRQGEGIRLVEAAIDGFGQRMTVEHRGQNWRLRLPLVGEFQIENAL
VAAGLVISTGGDAAQAFAALEHLEGAKGRLELVGDRFGAPVFVDYAHKPDALVKALEALR
PYAKGRLVVVFGAGGDRDAGKRPLMGEIAARHADTVIVTDDNPRSEDPAAIRAAILEAAP
GAQNIGDRAEAIRTAVAALAPGDVLLIAGKGHEIGQIVGDKVLPFSDHEAAAAALAEHAT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgcgatcttctcaggggtgaagccgccatcgacccgcaagcggcggagctt
gcggtcgcgggcgtggccgtggacagtcgtgcggtgaagccgggcgatgtgttcttcgcg
ctcggcggtcacaagaccgacggggcgcgctttatcgaagcggcggtgaaggcgggagcc
gtcgcggtcgtgaccggccatcctcacacggcaagcgtgcctgtcgtcgtcgcggacgat
ccgcgccgcgcgctcgcgctggcggcagcggtcgtctatccgcgccagccgcgcaccatc
gccgccgtcaccggcaccagcggcaagacatccgttgcggcgtttacccggcaggtgtgg
gacagtctcggccataatgcggcgagtctggggaccatcggcatcgtctcgcgccatcgc
aatgtctacggctcgctgacgacgcccgacccggtggcgctgcatcgggcgatcgacgaa
ctcgcgggcgatggcgtgacgcatctggcgctggaggcgtcctcgcacgggctcgaccag
catcggctcgacggtgtgcgcatcacggccaccgctttcaccaatctgtcgcgcgaccac
atggattatcatccgaccgtggagcattacctcgcgaccaagctgcggctgttcacggac
cttgcccccgagggtgcgccggcggtgatcgcagccgaccacgaacactccgccacggtg
atcgccgctgcacgtacgcataaactgaatgtcatgacggtcgggcggcagggcgagggc
attcgcctcgtcgaagctgcgatcgacggtttcgggcagcgcatgacggtggagcatcgc
gggcagaactggcgcctgcgtctgccgctggtcggcgaattccagatcgagaatgcgctg
gttgccgctggccttgtcatttccacgggcggcgatgcggctcaggcgttcgcggcgctc
gaacatctcgaaggcgcgaagggacgactcgaactggtgggcgatcgctttggcgcgccg
gtgttcgtcgattacgcccacaagccggatgcgctggtgaaggcgctggaagcgctgcgg
ccctacgcgaaaggccggcttgtcgtggtgttcggtgcgggcggtgaccgcgatgcgggc
aagcggccgttgatgggcgagattgccgcgcggcatgccgatacggtgatcgtcaccgac
gacaatccgcgcagcgaggatcccgccgccattcgcgcggccattcttgaagcagcgccg
ggcgcgcaaaatatcggcgatcgcgccgaggcgatccgcaccgccgttgccgcgcttgcg
cccggcgatgtgctgctgatcgcgggcaagggccacgagatcgggcagatcgtcggcgac
aaggtgttgccgttcagcgatcacgaagcggccgcggccgcgcttgcggagcacgcgaca
tga

DBGET integrated database retrieval system