KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_5624Help
Entry
OCAR_5624         CDS       T00783                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1565512..1566195
Genome map
AA seq 227 aa AA seqDB search
MDAVIKPLRSKLDKTEVPAAEIDQAGVRPDQPRPTREEAESAVKTLLSYIGENPSREGLL
DTPRRMVEAYDELFQGYHQCPAEVLNRTFGETAGYDDFVLIRDIEFHSHCEHHVMPFYGK
AHIAYTPVDRVVGLSKIARLVDAFAHRLQTQEHLTAQIAAALDKVLQPRGVAVLLEAEHT
CMSVRGIAKHGAKTVTSRFTGMFYDNPDEQNRFLHMVRGISAPFAGA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgttatcaagccgctgcgcagcaagctcgacaagactgaagtccctgccgcc
gaaatcgatcaggccggcgtccgcccggaccagccgcgtcccacgcgcgaggaggccgag
agcgcggtcaagacgttgctgtcctatatcggcgagaacccctcccgcgagggcctgctc
gatacgccgcgccgcatggtcgaggcctatgacgagctgtttcaggggtatcaccagtgc
ccggccgaggtgctgaaccgcaccttcggcgagaccgcgggctatgacgatttcgtgctg
atccgcgatatcgaatttcactcgcattgcgagcatcacgtcatgccgttctacggcaag
gcgcacatcgcctatacgccggtggaccgcgtggtcggcctgtcgaagatcgcgcgtctc
gtcgatgcgttcgcgcatcgcctgcagacccaagagcatctcaccgcccagatcgccgcg
gcgctcgacaaggtgctgcagccgcgcggcgttgccgtgctgctcgaggccgagcatacc
tgcatgtcggtgcgcggcatcgccaagcacggcgccaagacggtgacgtcgcgctttacc
ggaatgttctatgacaatccggatgagcagaaccgttttctccatatggtgcggggcatt
agcgcgccatttgcaggcgcttga

DBGET integrated database retrieval system