KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6005Help
Entry
OCAR_6005         CDS       T00783                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1934915..1935982)
Genome map
AA seq 355 aa AA seqDB search
MISLLEEHERTLAFAEVALGQIKSLRQSAIPRNYEIWYVYATGYNIELNKVINETLQHNG
RLTEADLEQIHETYLSPTRMTDRIDKVGSRVINEIDDVMSLITDAVGMTGSFSEDLDSAS
KRLVKAKDKAQINLIVHALLQSTREMSLTNKALEARLATSRLEIASLQDSLEAIRTESLT
DPLTSLGNRKYFDRALESAVEHASHHDEPLSLLMVDIDHFKSFNDNYGHLTGDQVLRLVA
LALKANIKGQDLTARYGGEEFVVILPNTSMRQALAVADNIRRAVMSKQLKKKSTGEILGR
VTISAGVSTFRPGDDAPALIDRADACLYAAKRHGRNRVICEADPEFTPNVRIQVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagtcttcttgaagaacacgagcgcaccctcgcgttcgccgaagtggcgttgggc
cagatcaagtccctgcgccagagtgcgatccctcgcaattacgaaatctggtacgtctac
gcgaccggctacaacatcgagctcaacaaggtcatcaacgagacgttgcagcacaacggc
cggctgaccgaggccgatctcgaacagatccacgaaacctatctgtcgccgacccgaatg
accgaccgcatcgacaaggtcggatcacgcgtcatcaacgagatcgacgacgtgatgagt
ctcatcaccgacgcggtcggtatgacgggttctttcagcgaggacctcgacagcgcaagc
aagcgtctcgtcaaggcgaaggacaaggcgcagatcaatctgatcgttcacgcgcttctt
caatcgacgcgggagatgagcctcaccaacaaggcgctggaggcgcggctcgccacgtca
cgcctcgagatcgccagcctgcaggacagccttgaagcgatccgcaccgagagcctgacc
gaccctctcacgtctctcggcaatcgcaaatatttcgatcgcgcgctggaatccgcggtg
gagcacgcaagccatcatgacgagccgctgtcgctgctgatggtcgacatcgatcacttc
aagtcgttcaacgacaattacggccacctcaccggcgaccaggtgcttcgcctggtggcg
ctcgcattgaaagccaacatcaagggtcaggacctgaccgcgcgctatggcggcgaggag
ttcgtggtcatcttaccgaacacctcgatgcgtcaggctttggctgttgccgacaacatc
cgccgcgccgtgatgtcaaagcagctcaagaagaagtcgaccggcgaaatcctcggtcgc
gtcacaatctccgccggcgtttcgaccttccggcccggcgacgacgcccccgctctgatc
gaccgcgccgacgcctgcctctatgccgccaagcggcacggccgcaatcgcgtgatctgc
gaagcagaccccgaattcacaccgaatgtccggattcaggtggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system