KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6086Help
Entry
OCAR_6086         CDS       T00783                                 

Definition
protein-L-isoaspartate
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Brite
Enzymes [BR:oca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     OCAR_6086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2027058..2027717
Genome map
AA seq 219 aa AA seqDB search
MPDALTSRWNMVDSQVRTADVTDLRLIEAMRATPREAFLPESQKALAYLDRDIALDGEDN
VYLIKPMVLGRLLQAADIEPTDRVLVTGGAAGYAAALAGRLGAEVVAVCANDKVAAASRS
ALEASGLSNITVTAGEAGQGDAARGPYDVIVLHGATEVVPQALYDQIKPGGRLVGVFAQS
VPSRATLVTRSEADFGARTLFDAAAPVLPGLKRLPGFTF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgctctgacttcccgctggaacatggtcgattcccaggttcgcaccgccgat
gtcacggatctgcgcctgatcgaggccatgcgggcgaccccgcgcgaggcatttcttccc
gagagccagaaggcgcttgcctatctcgatcgcgacatcgccctcgacggtgaggacaat
gtttatctcatcaagccgatggtgctcggccggctgctgcaggctgccgatatcgagccg
accgatcgggttctggtgacaggcggcgcagccggttatgcggcagcgctggcgggtcgt
ctcggggctgaggtcgtcgcggtctgtgccaatgacaaggtcgccgcggcaagccgctcg
gcgctcgaggctagcggcctctccaatatcacggtcacggcgggcgaggccgggcagggc
gatgctgccagggggccttacgacgtcatcgtgctccatggcgcgaccgaggtggttccg
caggccctctatgaccagatcaagcccggcggacgcctcgtcggcgtgttcgcgcaatct
gtgccctcgcgcgccaccctcgtgacccgctcggaggcagattttggcgcccggaccctg
ttcgacgccgctgcacccgttcttcccggccttaagcggttgccgggctttacattttga

DBGET integrated database retrieval system