KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6109Help
Entry
OCAR_6109         CDS       T00783                                 

Definition
glycosyl transferase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2054194..2055426
Genome map
AA seq 410 aa AA seqDB search
MERTSTSMMRTRCSIVIKLDQCDASVASTAMHRSHFFSRQGVVFMQHITRRDMIATCAGA
TVALLRGTESRSSIGESLGDAAASKNVMFGAAAAEAIDHDIGYRDLYISQARLITTDTAL
KMGTVASRPGVKRFEPADKLLQFCTTNRIGLRGHCVIWNEWVPQWVRNMALAERRSFFDG
YIEDVVGRYVGKLQSWDIVNEPFWPGHKAPGGYRLGPWYDAFGTDYVRRAFERAGAVDKA
TKFVLNEAQTERDDPLGLAVREGLLKLVKELKDSGVRLDVVGLQGHLQPKYKHDPVRFAD
FVHKLSELGVDIYITEFDVRDDTFPDDIRARDELVAKTAEAFLDNVLQISAVKAVIAWEL
ADQYSFYTDLAKKKDPSAARLPRPLPYDSNLQKKPLWFAMQRAFTNARRA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgaacatcgacatcgatgatgcgtactcgatgttcgatcgtcatcaaattggac
caatgcgacgcaagcgtggcgagcactgcaatgcacagatcacatttcttttcacgtcag
ggagtcgtcttcatgcaacacatcacgcgacgcgatatgatcgcaacatgcgctggcgcg
acagttgctttgttgcgcgggacagaatcacgatcgtcgattggcgagagtcttggtgat
gcagctgcaagcaagaatgtgatgttcggcgccgctgcagcggaagcaatcgatcacgat
atcggctatcgcgacctctacatctctcaggcacggctcatcacgacagatactgccttg
aagatgggcactgttgcatcacggccgggcgtgaagcgcttcgagcccgcggacaagctg
ttgcaattttgcacgacgaaccggatcggtctgcgaggtcactgcgtcatctggaacgag
tgggttccgcaatgggtccgcaacatggcgcttgccgagcggcgatcgttcttcgatggc
tacatcgaagacgtcgtcggccgttatgtcggcaagctgcaatcatgggacattgtgaat
gagccgttctggccggggcacaaggcgccgggcggatacaggttgggcccatggtacgat
gcattcggaacggattatgtccgccgtgctttcgagcgggcaggcgctgtcgacaaggct
acgaaattcgttcttaacgaagcgcagacggaacgcgatgatccactcggactcgcggtg
cgagaagggctcctcaaactggtcaaggagttgaaggattccggtgttcgtctggacgtc
gttgggctgcaggggcatctgcaaccgaaatacaagcacgatcccgtgcgatttgccgat
ttcgttcacaagctcagcgagcttggtgtcgacatctacatcacggaattcgatgtacgg
gacgatacgtttccggatgatatccgtgctcgcgacgagctggtggcaaagactgcggaa
gcgtttctcgacaatgtgctgcagatctcggcggtgaaggcggtgatcgcctgggagctt
gccgatcaatattcgttctacaccgatctcgccaagaagaaggacccgtccgccgcgcgg
ctgccgcgcccgctgccctacgattcgaatctgcagaagaagccgctgtggttcgcgatg
cagcgtgccttcaccaacgcacgccgggcatga

DBGET integrated database retrieval system