KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6300Help
Entry
OCAR_6300         CDS       T00783                                 

Gene name
pyrG
Definition
CTP synthetase (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OCAR_6300 (pyrG)
Enzymes [BR:oca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     OCAR_6300 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2241687..2243315)
Genome map
AA seq 542 aa AA seqDB search
MARYIFITGGVVSSLGKGLASAALGAVLQARGYKVRLRKLDPYLNVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFTGRPACKADNITTGRIYQEILAKERRGDYLGATVQVIPHVTN
AIKDFVLTGNEGFDFVLCEVGGTVGDIEGLPFFEAIRQIKNDLPRGEVIYIHLTLLPYIP
SAGELKTKPTQHSVKELRSIGIQPDILLCRTDRPIPKEERRKLGLFCNVRESAVIEARDA
DNIYAVPEAYHMAGLDDEVLAAFGIEAPPPALERWHEINARVRNPEGQVTIAVVGKYTGM
KDAYKSLIEALSHGGIANKVKVNLDWIESEVFEREDPAPFLEHVNGILVPGGFGQRGAEG
KIKAVRFARERRVPYFGICFGMQMAVIEAARNLVGIEGANSTEFGETKEPLVGLMTEWLR
GNELEKRSKAGDLGGTMRLGAFPAALRPGSRVSKIYGNALEISERHRHRYEVNTAYKDRL
EQHGLRFSGMSPDGVLPEIVEYEDHPWFVGVQYHPELKSRPLDPHPLFASFIEAAVVQSR
LV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggtatatcttcatcaccggcggcgtggtttcctcgctcggcaaaggtctggca
tcggcggctctcggggccgtcctgcaggcgcgaggctacaaggtccgccttcgcaagctc
gatccctatctcaacgtcgatcccggcacgatgtcgccgtatcagcacggcgaggtgttc
gtcaccgacgacggcgcggagaccgacctcgatctcggccactacgagcgcttcaccggc
cgcccggcgtgcaaggccgacaacatcaccaccggccgcatctatcaggagatcctcgcc
aaggagcgccgcggcgactatctcggcgcgaccgtgcaggtgatcccgcacgtcaccaac
gccatcaaggatttcgttctcaccggcaacgagggctttgacttcgtgctctgcgaggtc
ggcggcacggtgggcgatatcgagggcctgccgttcttcgaggcgatccgccagatcaag
aacgatctgccgcgcggtgaggtgatctacatccacctcacgctgctgccctacattccg
agcgcgggcgagctgaagaccaagccgacccagcattcggtgaaggaactgcgctcgatc
ggtatccagcccgacatcctgctctgccggaccgaccggccgatcccgaaggaagaacgc
cgcaagctcggcctgttctgcaacgtccgcgaaagcgcggtgatcgaggcgcgcgacgcc
gacaacatctacgcggtgcccgaggcctaccacatggcagggctcgacgacgaagtgctg
gccgccttcggtatcgaagcgccgccgcccgcgctggagcgctggcacgagatcaacgcc
cgggtgcgcaacccggaagggcaggtgacaatcgccgtcgtcggcaagtacaccggcatg
aaggacgcctacaaatcgttgatcgaggcgctgtcccatggcggcatcgccaacaaggtg
aaggtcaacctcgactggatcgagagcgaggtgttcgagcgcgaggaccctgcgccgttc
ctcgaacacgtcaacggcattctggtgccgggcggcttcggccagcgcggtgcggaaggc
aagatcaaggcggtgcggttcgcgcgcgaacgccgcgtgccgtatttcggcatctgcttc
ggtatgcagatggcggtgatcgaggccgcgcggaatcttgtcggcatcgaaggcgcgaac
tcgaccgaattcggcgagaccaaggaaccgctggtcggcctgatgaccgagtggctgcgc
ggcaacgaactcgagaagcgctcgaaggctggcgaccttggcggcaccatgcggctcggt
gcttttccggcggcgctgcgccccggcagccgcgtgtcgaagatttacggcaacgcgctg
gagatttccgagcgccaccgccaccgctacgaggtcaataccgcctacaaggaccgcctc
gagcagcacggcttgcggttctcgggcatgtcaccggacggcgtattgcccgagatcgtc
gaatacgaagaccacccgtggttcgtcggcgttcaataccatcccgaattgaagtcgcgc
ccgctggacccgcatccgctgtttgcctccttcatcgaggcagcggtggtgcagagccgt
ctggtgtaa

DBGET integrated database retrieval system