KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6302Help
Entry
OCAR_6302         CDS       T00783                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_6302 (tpiA)
   01230 Biosynthesis of amino acids
    OCAR_6302 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCAR_6302 (tpiA)
   00051 Fructose and mannose metabolism
    OCAR_6302 (tpiA)
   00562 Inositol phosphate metabolism
    OCAR_6302 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCAR_6302 (tpiA)
Enzymes [BR:oca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OCAR_6302 (tpiA)
Exosome [BR:oca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OCAR_6302 (tpiA)
  Exosomal proteins of bladder cancer cells
   OCAR_6302 (tpiA)
  Exosomal proteins of melanoma cells
   OCAR_6302 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2244117..2244872)
Genome map
AA seq 251 aa AA seqDB search
MPGKIRPLIAGNWKMNGLKASLGELAAIGKGAGEVWRRVDLLICPPATLIFPAAAAMIGS
KVAIGGQDCHAEASGANTGDISAEMLADAGATYVIVGHSERRTDHGETDAVVRAKAEAAW
RAGLVAIVCVGETRAERDAGRAAEVVGRQLDGSVPDGARAANLVVAYEPVWAIGTGLTPT
SQDIEEIHAVIRQNLTGRFKAEGEGVRLLYGGSLKPANAAEILALANVNGGLIGGASLKA
ADFLAIAEACP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcaagatccgaccgctgatcgcggggaactggaagatgaacggcctcaaggcc
tcgctcggtgaacttgcggcgatcggcaagggtgcaggcgaagtctggcgcagggtcgat
cttctgatctgcccgcctgcgacgctgatcttcccggcggccgctgccatgatcggatcg
aaggtcgcgatcggcgggcaggactgtcacgctgaggcttccggcgccaataccggcgat
atctccgccgagatgctggccgatgcgggggccacgtacgtcatcgtcgggcactccgag
cgccgcaccgaccatggcgagaccgacgcggtggtgcgggcgaaggcggaggctgcctgg
cgcgccgggcttgtcgccatcgtctgtgtcggcgagacgcgggccgagcgcgatgcgggc
cgggccgccgaggtagtcggccgccagcttgatggttcggttcccgacggggcgcgtgcg
gccaatctggtcgtggcctacgagccggtctgggcgatcggaaccgggctcacgccgacc
tcgcaggatattgaagaaatccatgccgttatccggcaaaacctgacaggccggtttaag
gcggaaggcgagggtgtgcgccttctttatggcgggtcgctgaagcctgccaacgccgcc
gaaatcctcgcgctggccaacgtcaatggcggcctgattggtggggcgagcctcaaggcg
gccgacttccttgcgatcgcggaggcctgtccttaa

DBGET integrated database retrieval system