KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6305Help
Entry
OCAR_6305         CDS       T00783                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01130  Biosynthesis of antibiotics
oca01230  Biosynthesis of amino acids
Module
oca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCAR_6305 (trpC)
Enzymes [BR:oca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OCAR_6305 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACI93418
UniProt: B6JG29
Position
2248028..2248825
Genome map
AA seq 265 aa AA seqDB search
MSDILQKIERYKREEIASAKAAHPQAEVEAAARHAPALRGFAKAIRDRLAHKQFALIAEI
KKASPSKGLIRADFDPPALARAYEAGGATCLSVLTDTPSFQGHLDFMVAARAATSLPVLR
KDFMYDTYQVMEARAHGADCILIIMAALDDAAARDIEAAALDLGMDVLLEVHNEPELERA
LKLRSKLLGINNRNLRTFETTLATSEALAASVPNDRIMVGESGIFTPADIARLARVGIET
FLVGESLMRQTDVTSATRTLLAKAS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgacatcctgcaaaagatcgaacgctacaagcgcgaggaaatcgcctctgccaag
gctgcgcatccgcaggccgaggtcgaggcggccgcgcgccatgcgccggccctgcgcggg
tttgcgaaggcgatccgcgaccggcttgcgcacaagcaattcgcgctgattgccgagatc
aagaaggcgtcgccttcaaaaggcttgatccgcgccgatttcgatccgcctgcgctggcg
cgcgcctatgaggcgggtggcgcgacctgcctgtccgtgctcaccgacacgccctcgttt
cagggccacctcgattttatggtggcggcgcgcgcggccacctcactgccggtgctgcgc
aaggacttcatgtacgacacctatcaggtgatggaggcgcgtgcgcatggcgccgactgc
atccttatcatcatggcggcgctcgatgacgccgccgcacgcgacatcgaggctgcagcg
ctcgacctcggcatggatgtgctgctcgaagtacacaacgaacccgagcttgagcgcgca
ttgaagctgcgctcaaagcttctcggcatcaacaaccgcaacctgcgcaccttcgagacc
acgcttgcgaccagcgaggcgctcgccgcctccgtaccgaatgatcgcatcatggtcggc
gagagcggcatcttcacgcccgccgacattgcgcggctggcccgcgtcggcatcgagacg
ttcctcgtcggcgaaagcctgatgcggcagaccgacgttacatccgccacccgcaccctg
cttgcgaaggcctcatga

DBGET integrated database retrieval system