KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6363Help
Entry
OCAR_6363         CDS       T00783                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00230  Purine metabolism
oca01100  Metabolic pathways
Module
oca_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OCAR_6363 (gmk)
Enzymes [BR:oca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     OCAR_6363 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 cobW RsgA_GTPase ABC_tran AAA_18 AAA_29
Motif
Other DBs
NCBI-ProteinID: ACI93476
UniProt: B6JGM9
Position
complement(2306702..2307352)
Genome map
AA seq 216 aa AA seqDB search
MSGNARTGERRGLMFVLSSPSGAGKSTLSRMLVENTRGLRMSISATTRPMRPGEVEGEHY
YFIDKPRFDAMVLAGEFLEHAPVFDNHYGTPRAPVERALAAGEDVLFDIDWQGTQQLREK
ARADVVSVFILPPSASDLERRLHTRAQDSDAVIRGRMDRATHELSHWAEYDYVVINNDLG
RAFGEIETILRAERLKRERQTGLSTFVRDLQTQLKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaatgcacgcacgggagagcggcgtggcctgatgttcgtgctgtcctcaccc
tcgggcgcgggcaagtcgacgctgtcgcggatgctggtcgagaatacgcgcggtctgcgg
atgtcgatctcggcgacgacgcggccgatgcggccgggcgaagtcgagggcgagcattat
tacttcatcgacaagccgcgcttcgacgcgatggtgcttgcgggcgaattcctcgaacat
gcgccggtgttcgacaatcattacggtacgccgcgcgcgccggtcgagcgggcgctcgca
gccggcgaggacgtgctgttcgacatcgactggcagggtacgcagcaattgcgcgagaag
gcacgggccgatgtcgtcagtgtcttcatcctgccgccgtcggcatctgacctcgaacgc
aggctgcacacgcgcgcgcaggattccgacgcggtgatccgcgggcggatggatcgtgcg
acccatgaactgagccactgggccgaatacgattatgtcgtgatcaataacgatctcggc
cgggcgtttggcgagatcgagacgatcctgcgcgccgagcggctgaagcgcgaacgccag
accggcctttcgactttcgtgcgcgatctgcagacccagttgaagaagtaa

DBGET integrated database retrieval system