KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6554Help
Entry
OCAR_6554         CDS       T00783                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_6554
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCAR_6554
   00640 Propanoate metabolism
    OCAR_6554
   00660 C5-Branched dibasic acid metabolism
    OCAR_6554
Enzymes [BR:oca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OCAR_6554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2495429..2496625
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLREFGVSVSKGVPILKASDAEAAAKQLGGPVWVVKSQIHAGGRGKGKFK
EASAGDKGGVRLAKSIDEVKQFVDQMLGKTLVTVQTGPAGKQVNRLYLEEGADIDKEFYL
SALVDRETSRIAFVVSTEGGMDIEKVAHDTPEKIVTFSVDPATGIMPHHGRKVAQALKLK
GDQAKQAEKLVNQLYTAFIAKDMSMLEINPLILSKQGELRCLDAKISFDSNAIYRHPDVM
ELRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGESPANFLDVG
GGASEEKVTAAFKIITADPNVKGILVNIFGGIMKCDVIAAGVVAAVKAVGLKVPLVVRLE
GTNVEEGKKIIRESGLNVLPADDLDDAAQKIVKAVKGK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagtatcaagctaaagccgtcctgcgggagttcggcgtctctgtttcc
aagggcgttccgatcctcaaggcgtcggacgcggaagcagccgccaagcagctcggcggt
ccggtgtgggtggtgaagagccagatccacgccggcggccgcggcaagggcaagttcaag
gaagcctctgccggcgacaagggtggcgttcgtctcgccaagtcgatcgacgaggtgaag
cagtttgtcgatcagatgctcggcaagacgcttgtgaccgtgcagaccggccccgccggt
aagcaggtcaaccgcctctatctcgaggaaggtgcggacatcgacaaggagttctacctg
tcggcgctcgttgaccgcgagacctcccgtatcgccttcgtggtttccaccgaaggcggc
atggacatcgagaaggtcgcccacgatacgcccgagaagatcgtcaccttctcggtcgat
ccggcgaccggcatcatgccccatcacggccgcaaggtcgcgcaggcgctgaagctgaag
ggcgaccaggccaagcaggccgagaagctcgtcaaccagctctacacggccttcattgcg
aaggacatgtcgatgctcgagatcaacccgctgatcctgtccaagcagggtgagctgcgt
tgcctcgacgccaagatctcgttcgattcgaacgcgatctatcgtcatcccgacgtgatg
gagcttcgcgacgagaccgaggaagacgcgaaggaaatcgaggcgtcaaagtacgacctc
gcctacatcgcgctcgacggcaccatcggctgcatggtcaatggcgccggcctcgcgatg
gccacgctcgacatcatcaagctgtatggcgagagcccggccaacttcctggacgtcggt
ggcggcgcttccgaggagaaggtcactgctgcgttcaagatcatcactgccgatccgaac
gtgaagggcatcctcgtcaacatcttcggcggcatcatgaagtgcgacgtgatcgctgcc
ggcgttgttgccgcggtgaaggccgtcggcctcaaggtgcctctggtggttcgcctcgaa
ggcaccaacgtcgaggaaggcaagaagatcatccgtgaaagcggcctcaacgttctgcca
gccgacgatctggacgacgccgcgcagaagatcgtcaaagctgtgaagggaaagtaa

DBGET integrated database retrieval system