KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6584Help
Entry
OCAR_6584         CDS       T00783                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2528853..2529383)
Genome map
AA seq 176 aa AA seqDB search
MLHAAPAVRVVVPAKISESGLELVKAFESCMARIKGRPGCFRPYRDRAGILTIGWGHTNH
HLPHFTRDAVWTQAECDAALAGDMITFERYVQRLCKIELAQHEFDALVSWAFNTGGPATA
TLWKKLNAGNKKAVPIELAKWNRAGGRVLAGLTRRRKAEGLMFAGDVKGALALAHA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacgctgccccggcggtgcgcgtcgtcgtgcctgcaaagatcagcgaaagcggc
ctcgagcttgtgaaggcgttcgagagctgtatggcaaggatcaagggcaggccgggatgt
ttccgaccatatcgggacagggcgggcattctcaccatcggctggggccacaccaatcat
catctgccgcattttacgcgcgatgccgtctggacgcaggctgagtgcgatgccgcgctc
gcgggcgacatgatcacgttcgagcggtacgtacagcggctttgtaaaatcgaactcgcg
caacatgagttcgatgcgttggtgtcgtgggctttcaatacgggcgggccggccactgcg
actctctggaagaaacttaacgccggaaacaagaaagccgtgccaatcgagcttgcgaag
tggaacagggcaggcggcagagtattggccgggctgacgcgccgccgcaaagcggaaggg
ctgatgttcgccggcgacgtcaagggcgcgctggcgctcgcgcatgcatga

DBGET integrated database retrieval system