KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6642Help
Entry
OCAR_6642         CDS       T00783                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oca00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2577257..2578111
Genome map
AA seq 284 aa AA seqDB search
MTARSSTFGTSASTRHDILPALLGKPHPLVMGVLNVTPDSFSDGGRFLDPATALAQAERM
VAEGADILDVGAESTRPYGSVRISEEDELARLRPILPALTRLGVPISIDTMKAGVAAWAL
DQGAAIANDVWGLHRDPAMARLAAARGVPVVVMHNRDAADPAIDIMDDIAAFFTRSLAIA
DEAGLPRERIVLDPGIGFGKTAEQSMIALARLGELGRFGLPILVGASRKRFIASISPSEP
DQRIGGSLAAHLIAVQNGARIIRAHDVHETVQALRVAAAIGDKR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgctcctcaacctttggcacttcagccagcacccggcacgacatattgccc
gcgctgctgggaaagccgcatccgctggtgatgggggtgctcaatgtgacgccggattcc
ttctccgacggcggccgttttctcgatcccgccaccgcgcttgcccaggccgagcggatg
gtggctgaaggcgccgacattctcgatgtcggagcggaatcgacccgtccctacggctcg
gtccggatttcggaagaggacgaactggcgcggctgcggcctattctgcccgccctcacc
cggctcggcgtgccgatctcgatcgacaccatgaaggccggcgtcgccgcctgggcgctc
gatcagggtgccgcgattgcaaacgacgtctgggggctgcaccgcgaccccgcgatggcg
cgccttgcggccgcacgtggcgtgcccgtcgtggtgatgcacaatcgcgatgccgccgac
ccggccatcgacatcatggacgacatcgcggccttcttcacccgctcgctcgcaatcgcc
gacgaggccggcctgccgcgcgagcgcatcgtgctcgatcccggcatcggcttcggcaag
accgccgagcaaagcatgatcgcgctggcccgccttggcgaactgggccggttcgggttg
cccattctggtgggcgcttcgcgcaagcgcttcatcgccagtatctcgccatccgaacca
gatcagcgcatcggcggctctcttgcggcgcatctcatcgcggttcagaatggtgcccgc
atcattcgcgcgcatgacgtccatgagaccgtccaggcgctgcgcgtggcggctgcaatc
ggggacaagcggtga

DBGET integrated database retrieval system