KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6822Help
Entry
OCAR_6822         CDS       T00783                                 

Gene name
xfp
Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OCAR_6822 (xfp)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OCAR_6822 (xfp)
Enzymes [BR:oca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     OCAR_6822 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2786353..2788746)
Genome map
AA seq 797 aa AA seqDB search
MVADTSLTDHELGLIDAWWRAANYLSVGQVYLLDNPLLKIPLAIEHVKPRLLGHWGTVPG
LNFIYAHLNRLIKARDLNILFVTGPGHGAPGIIANAYLEGTYSELCPAITQDIEGIKRLF
RQFSFPGGVPSHTAPETPGSIHEGGELGYSLSHAFGAAFDNPELIIACVVGDGEAETGPL
AAAWHSNKFLNPASDGAVLPILHLNGYKIANPTVLARIPSEEIRALFEGYGYAPIFVEGH
DHFQMHRKMALALSTAFSDIAKIQKTARSERNPERPRWPMIVLRTPKGWSGPKTVDGQKT
EGSWRSHQVPFSNIRAPGHLQLLENWLRSYLPERLFDDLGRLCPEIAALAPEGAKRMSAN
PHANGGTKRRPLCLPDFTSFAVDVEAPGQVDAEATRVLGGFLRDTMAANKANRNFRVFGP
DETASNRLQALFDVTDRSWNAEIIPDDDDLGPDGRVMEILSEHTCQGWLEGYLLTGRHGF
FSCYEAFIHIVDSMFNQHAKWLKTAREVPWRQPIASLNYLLTSHVWQQDHNGFSHQDPGF
IDHVINKKADIVRVYLPPDANTLLYVADHCLRSWDRVNVIIAGKAPSPQWLSMDAAIKHC
TEGIGIWEWASNDRGSEPDVVMACAGDVPTLETLAAVDLLEQQIPELKIRVVNVVDLMTL
QSKEQHPHGLADNDFDALFTTDKPVIFAYHGYPTLIHRLTYKRTNHHNIHVRGYEEEGST
TTSFDMAVRNRIDRFHLIAAVIDWVPQLGAAAVYTKQAIRDKLVEHERFIRTHGVDLPEV
RNWRWKGAQRPATDAFR
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggtagcggacacatccctgacggatcacgagcttggtctcattgatgcctggtggcgg
gcggccaattatctttctgtcggtcaggtttacctgctcgacaatccgctcttgaaaatt
ccgctcgctatcgagcacgtcaagccgcgtctccttggccactggggaacggtgccgggg
cttaacttcatctacgcgcatctcaatcgtctcatcaaggcgcgagacctgaacattctg
tttgtgactgggcccggtcatggcgctccgggaattattgcgaacgcttatctcgagggc
acctacagcgaactctgtcctgcaatcacgcaggatattgaaggcatcaagcgcctgttc
cgccaattttcgtttcccggtggtgtgccaagccacaccgcacctgaaacgccgggctct
atccatgaaggtggtgagctcggctactcgctatcccatgcttttggagcggcgttcgac
aatccggaattgattattgcttgcgtggtcggcgacggggaggccgagaccgggccgctt
gctgccgcctggcacagcaacaagtttctcaacccggcgtccgatggtgccgtgctgccg
atccttcatctcaacggctacaagatcgccaacccaaccgttcttgcgcgcattccttcg
gaggaaattcgcgccttgtttgaaggttacggatatgcgccgatcttcgtagaggggcac
gatcatttccagatgcatcggaagatggcgttggcgctctcaactgccttctccgatatc
gcaaaaatccaaaaaacagcccgaagcgaacgtaatcctgagcggccgcgttggccgatg
attgttctgcgaaccccaaagggatggtccgggccgaagacggtggatggccagaagacc
gaaggatcatggcgatcgcatcaggtccctttcagtaacatacgagcccccggtcacctg
cagcttctggagaactggcttcgaagctaccttccggagcggctgttcgatgatcttggc
cggctttgccccgagatcgcggccctcgcgccggaaggggcaaagcggatgagcgccaac
cctcatgcgaatgggggcaccaaaaggcggccgctctgccttcctgacttcacgtcattc
gcggttgatgtggaagctccaggacaggtcgacgcggaggcaacgcgcgtgctgggtggc
ttcctccgcgacaccatggcggcgaacaaagccaaccgcaatttccgcgtattcggtccg
gacgagacagcttcaaatcgactacaggctctgttcgacgttaccgaccggtcatggaat
gccgaaataatcccggacgatgatgaccttggtcccgatggccgcgtcatggagattctg
agcgaacacacctgccagggatggctcgaaggctatctgctgaccggccgccacggcttc
ttctcttgctatgaggccttcattcacattgtagattcgatgttcaaccagcatgccaag
tggctgaaaaccgctcgggaggtgccatggcgccagccgattgcctcgttgaattatttg
ctcacttcgcacgtctggcagcaggaccacaatggtttcagccatcaggatcccgggttc
atcgatcacgtcatcaacaagaaggccgatatcgtccgcgtttatctgccgcccgacgca
aacactctgctgtatgtggccgatcactgcctgcggagctgggatcgcgtcaatgtcatc
attgctggtaaggcgccgagcccgcagtggctctcgatggatgctgcgatcaaacactgc
acggaaggaatcggaatttgggaatgggccagcaacgatcgcggcagcgagccggacgtc
gtcatggcgtgcgcgggtgacgtgccgacgctggagacgcttgctgctgtcgatttgctg
gagcagcagattccggaattgaaaattcgggtcgtgaatgtcgttgatctgatgacgctg
caatcaaaagaacagcatccgcacgggctggccgacaacgatttcgatgcgctgttcacc
acggacaagccggtgatctttgcttatcacggctatccgacgttaattcatcggctgacc
tacaaacgtacaaatcaccacaatatccatgtgcggggctatgaagaggagggctccacg
acgacctcctttgatatggctgttcggaacaggatcgatcgatttcatctgattgcggct
gtcattgactgggtgccgcagcttggcgcggccgccgtctacaccaaacaggctattcgc
gacaaactggttgagcacgagcgtttcatccgtactcacggcgtcgatctgcctgaggtg
agaaactggcgatggaaaggtgcacagagacccgccacagacgcctttcgttga

DBGET integrated database retrieval system