KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6826Help
Entry
OCAR_6826         CDS       T00783                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OCAR_6826
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCAR_6826
  Lipid metabolism
   00071 Fatty acid degradation
    OCAR_6826
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCAR_6826
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OCAR_6826
   00626 Naphthalene degradation
    OCAR_6826
Enzymes [BR:oca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OCAR_6826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2790517..2791500)
Genome map
AA seq 327 aa AA seqDB search
MRAMVLSGPGAELKMADLPDPVPQPGQVRVRVGACGVCRTDLHVMDGELPHIKYPIIPGH
EIVGRVDAIGPGVSNHCLGERVGVPWLGHTCGECFYCRSEMENLCDDPLFTGYTRDGGFA
THTVVDADFAFPLEEEGPDEAVAPLLCAGLIGWRSLVMAGDAKRLGIYGFGAAGHIVAQV
AKWQGRSIYAFTRGDDAAAQAFARELGAVWAGSSDALPPEPLDAAILYAPVGSLVPAALR
AVRKGGRVVCAGIHMSDIPSFPYSLLWEERQIVSVANLTRRDGIEFLRIVPQAKVQTHTT
VFQLGRANEALAMLRQGSLVGAAVLKP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggttctgagcggaccgggagcggaactcaagatggccgatctgccggat
cctgttccacagcccggccaggtgcgcgtgcgggtcggtgcctgtggcgtctgccgaacc
gatcttcacgtcatggacggcgagttgccgcatatcaaatatccgatcattcccggacat
gagattgtcgggcgcgtggacgcgatcggacctggcgtctccaaccattgtcttggcgag
cgggtcggtgttccctggcttggtcacacctgcggggagtgtttttactgcaggagcgag
atggaaaatctttgcgatgatcctctgttcaccggctatacgcgggatggcggatttgcg
acgcacacggttgtcgacgcagatttcgcgtttccgttggaagaggagggacctgacgag
gcggttgccccgttgctttgcgccggcctgatcggctggcgctcgctggtcatggccggt
gatgcaaagcgtcttggaatatatggttttggggcagccggccatatcgtggcgcaagtg
gcgaagtggcaaggccggtcgatttatgcctttacccgcggcgatgatgctgcagcgcaa
gcctttgcgagagagttgggcgcggtatgggccggttcctccgacgcgttgccgccggag
cctctcgatgccgcgatcctgtatgcgcctgtcggctctcttgttcctgcggcgctgcgc
gcggtgcggaaaggcggccgtgtcgtgtgcgccggcattcacatgagcgatatcccatcc
tttccgtacagcttgttatgggaagaacgacagatcgtctcggtcgcaaacctgacccgt
cgcgacgggatcgagtttctcagaatcgtgccccaagccaaggtccagacgcataccacg
gtcttccaacttgggcgcgccaacgaggcgcttgccatgttgcgacaaggaagtctggtc
ggggcggccgtcctcaagccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system