KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6826Help
Entry
OCAR_6826         CDS       T00783                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca00010  Glycolysis / Gluconeogenesis
oca00071  Fatty acid degradation
oca00350  Tyrosine metabolism
oca00625  Chloroalkane and chloroalkene degradation
oca00626  Naphthalene degradation
oca01100  Metabolic pathways
oca01110  Biosynthesis of secondary metabolites
oca01120  Microbial metabolism in diverse environments
oca01130  Biosynthesis of antibiotics
oca01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCAR_6826
  Lipid metabolism
   00071 Fatty acid degradation
    OCAR_6826
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCAR_6826
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OCAR_6826
   00626 Naphthalene degradation
    OCAR_6826
Enzymes [BR:oca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OCAR_6826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACI93936
UniProt: B6JHC7
Position
complement(2790517..2791500)
Genome map
AA seq 327 aa AA seqDB search
MRAMVLSGPGAELKMADLPDPVPQPGQVRVRVGACGVCRTDLHVMDGELPHIKYPIIPGH
EIVGRVDAIGPGVSNHCLGERVGVPWLGHTCGECFYCRSEMENLCDDPLFTGYTRDGGFA
THTVVDADFAFPLEEEGPDEAVAPLLCAGLIGWRSLVMAGDAKRLGIYGFGAAGHIVAQV
AKWQGRSIYAFTRGDDAAAQAFARELGAVWAGSSDALPPEPLDAAILYAPVGSLVPAALR
AVRKGGRVVCAGIHMSDIPSFPYSLLWEERQIVSVANLTRRDGIEFLRIVPQAKVQTHTT
VFQLGRANEALAMLRQGSLVGAAVLKP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggttctgagcggaccgggagcggaactcaagatggccgatctgccggat
cctgttccacagcccggccaggtgcgcgtgcgggtcggtgcctgtggcgtctgccgaacc
gatcttcacgtcatggacggcgagttgccgcatatcaaatatccgatcattcccggacat
gagattgtcgggcgcgtggacgcgatcggacctggcgtctccaaccattgtcttggcgag
cgggtcggtgttccctggcttggtcacacctgcggggagtgtttttactgcaggagcgag
atggaaaatctttgcgatgatcctctgttcaccggctatacgcgggatggcggatttgcg
acgcacacggttgtcgacgcagatttcgcgtttccgttggaagaggagggacctgacgag
gcggttgccccgttgctttgcgccggcctgatcggctggcgctcgctggtcatggccggt
gatgcaaagcgtcttggaatatatggttttggggcagccggccatatcgtggcgcaagtg
gcgaagtggcaaggccggtcgatttatgcctttacccgcggcgatgatgctgcagcgcaa
gcctttgcgagagagttgggcgcggtatgggccggttcctccgacgcgttgccgccggag
cctctcgatgccgcgatcctgtatgcgcctgtcggctctcttgttcctgcggcgctgcgc
gcggtgcggaaaggcggccgtgtcgtgtgcgccggcattcacatgagcgatatcccatcc
tttccgtacagcttgttatgggaagaacgacagatcgtctcggtcgcaaacctgacccgt
cgcgacgggatcgagtttctcagaatcgtgccccaagccaaggtccagacgcataccacg
gtcttccaacttgggcgcgccaacgaggcgcttgccatgttgcgacaaggaagtctggtc
ggggcggccgtcctcaagccttga

DBGET integrated database retrieval system