KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6885Help
Entry
OCAR_6885         CDS       T00783                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OCAR_6885
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCAR_6885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2845928..2846368)
Genome map
AA seq 146 aa AA seqDB search
MDGALRFDLLNKKKEKKMRWMIAAATLVALVGTAHAEGDVTKGEQAFKVCMACHAVGPGA
KNKVGPELNGIVGRKWAAVEGYNYSADLTAGKNSKVWDEATLDDYITNPKHLAPRGKMAF
PGISQAGKRADVIAYLKQFDASGNKK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggacggagcgttgcggttcgatttgttgaacaaaaaaaaggagaagaaaatgcgttgg
atgattgcagccgccaccctcgttgcccttgtcggcacggcccatgccgaaggcgacgtt
accaagggcgagcaggcattcaaggtgtgcatggcctgtcacgcggtcggccccggcgcc
aagaacaaggtcggtcctgagctcaacggcatcgtcgggcgtaagtgggccgcagtcgaa
ggttataattactcagccgatctgacggcaggtaagaacagcaaggtttgggacgaggcg
acgctcgacgactacatcaccaatccgaagcaccttgcgccgcgcggcaagatggcgttt
cccggcatctcgcaggccggcaagcgtgcggacgtgattgcctatctcaagcaattcgac
gcgagcggcaacaagaagtaa

DBGET integrated database retrieval system