KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_6885Help
Entry
OCAR_6885         CDS       T00783                                 

Definition
(GenBank) cytochrome c2
  KO
K08738  cytochrome c
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
oca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:oca00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCAR_6885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Flavi_NS5
Motif
Other DBs
NCBI-ProteinID: ACI93994
Position
complement(2845928..2846368)
Genome map
AA seq 146 aa AA seqDB search
MDGALRFDLLNKKKEKKMRWMIAAATLVALVGTAHAEGDVTKGEQAFKVCMACHAVGPGA
KNKVGPELNGIVGRKWAAVEGYNYSADLTAGKNSKVWDEATLDDYITNPKHLAPRGKMAF
PGISQAGKRADVIAYLKQFDASGNKK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggacggagcgttgcggttcgatttgttgaacaaaaaaaaggagaagaaaatgcgttgg
atgattgcagccgccaccctcgttgcccttgtcggcacggcccatgccgaaggcgacgtt
accaagggcgagcaggcattcaaggtgtgcatggcctgtcacgcggtcggccccggcgcc
aagaacaaggtcggtcctgagctcaacggcatcgtcgggcgtaagtgggccgcagtcgaa
ggttataattactcagccgatctgacggcaggtaagaacagcaaggtttgggacgaggcg
acgctcgacgactacatcaccaatccgaagcaccttgcgccgcgcggcaagatggcgttt
cccggcatctcgcaggccggcaagcgtgcggacgtgattgcctatctcaagcaattcgac
gcgagcggcaacaagaagtaa

DBGET integrated database retrieval system