KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7022Help
Entry
OCAR_7022         CDS       T00783                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCAR_7022
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCAR_7022
Enzymes [BR:oca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     OCAR_7022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2980366..2982003)
Genome map
AA seq 545 aa AA seqDB search
MNYQARDITDHAVQGPSSYESEIKAAEALLKDKPTWNGVTAEAIARMRLQNRFTTGLDVA
RYTAALMRADMAAYDADPTKYTQSLGCWHGFVAQQKLISIKKHFGGKTDRCYLYLSGWMV
AALRSEFGPLPDQSMHEKTTVPDLIRELYSFLRQADSRELNDIFRELDAAREAGDKAREA
AAIAKIDGFHTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQ
DGKVTVPHEVFLAKIRACRHAFLELGVEDGIIVTRTDSLGAGLTQQIAVSHKPGDLGDQY
NSFLDCEEVDATKIGNGDVIISRNGKLLRPKRLASNLYQFRPGTGADRCVLDCITSLQNG
ADLLWIETERPNIAQVASMVDRIREVIPNAKLAYNNSPSFNWTLNFRWQVFDEWKAAGKD
VSKYNRAELMKAEYDDTPLAIEADQLIRTFQADSAKRAGVFHHLITLPTYHTEALTMNNL
AKDYFGGQGMLGYVKHVQRQEIRQGIACVKHQNMAGSDIGDDHKEYFAGDAALKAGGVHN
TMNQF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcaggcacgcgacatcaccgaccatgcggtccagggtccgtcttcctacgaa
agcgagatcaaggcggccgaagccttgctcaaggacaaacccacctggaacggcgtcacg
gcggaagccattgcccgcatgcgcctgcagaaccggttcacgacaggtctcgatgtcgcg
cgctacacggcggccctgatgcgtgcggatatggccgcgtatgacgcggaccccaccaaa
tacacccagtcgctcggttgctggcacggctttgtcgcgcagcagaagctgatctcgatc
aagaagcatttcggcggcaagaccgaccgttgctacctgtatctgtcgggatggatggtc
gcagcgctgcgctcggaattcgggccgctgccggatcagtcgatgcacgagaagaccacc
gtgccggatctcatcagggaactctactcgttcctgcgtcaagccgactcgcgcgaactc
aacgacatctttcgcgaactcgatgccgcgcgtgaggccggcgacaaggccagggaagcc
gcggcgatcgcgaagattgatggcttccacactcatgtcgtgccggtgattgccgacatc
gatgccggcttcggcaacgcggaggcgacgtatctgctcgcaaagaagatgatcgaagca
ggcgcctgcgcattgcagatcgagaatcaggtctccgacgagaagcagtgcggccatcag
gacggcaaggtcactgtgccgcatgaagtgttcctggcgaagatccgcgcttgccgccat
gcgttcctcgaactcggtgtcgaagacggcatcatcgtcacccgtaccgactcgctcggt
gccggcctgacccagcagatcgccgtcagccacaagccgggcgatctcggcgaccagtac
aacagcttcctcgattgcgaggaggtcgatgccaccaagatcggcaacggcgacgtcatc
atcagccgcaacggcaagctgctgcgcccgaagcgtctggcgagcaacctgtatcagttc
cgtccgggtacgggtgcggaccgctgcgtgctggattgcatcacgtcgctgcagaacggc
gcggacctgctgtggatcgaaaccgagaggccgaacatcgcgcaggtcgcgagcatggtc
gatcgcatccgcgaggtgatcccgaacgcgaagctcgcctacaacaactcgccgtcgttc
aactggacgctgaacttccgctggcaggtgttcgacgagtggaaggcggccggcaaggac
gtcagcaaatacaaccgcgccgagttgatgaaggcggaatacgacgacacgccgctggct
atcgaagccgaccagttgatccgcacgttccaggcggattcggcgaagcgggccggcgtc
ttccaccacctcattacgctaccgacctatcacaccgaggccctgacaatgaacaatctc
gccaaggactatttcggtgggcagggcatgctcggctacgtcaagcacgtgcagcgtcag
gaaatccgccagggcattgcctgcgtcaagcatcagaacatggccggctcggacatcggc
gacgaccacaaggaatactttgccggtgatgcggccctgaaggcgggcggcgttcacaac
accatgaaccagttctga

DBGET integrated database retrieval system