KEGG   Oligotropha carboxidovorans OM5 (Mississippi): OCAR_7061Help
Entry
OCAR_7061         CDS       T00783                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
oca  Oligotropha carboxidovorans OM5 (Mississippi)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCAR_7061 (malQ)
Enzymes [BR:oca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OCAR_7061 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3015158..3016933)
Genome map
AA seq 591 aa AA seqDB search
MEKNDLVARLSHLPAWRVCDANGDVLASEMDGVSGESDLPFGVYRLQDSDAGERSLIIAP
EHAYEGAFDRRWILSVQLYGVRSERNWGIGDFSDLQTLLRWSATCGAAGVGLNPLHALFD
DEGDDCSPYAPNSRLFLNSIYIDVAALPELPENFATEHAAEIERLRNAEFVDYAGVAALK
QRALRLAFAQFNKWTTLKRRAAFDAFRERGGATLARFASFEALRRKYKIAWWDWPEPWRA
PDDDALADLRRGEDADAVAFAEFVQWCAHEQLQACVDLARALDLPVGLYLDIAVGVRAGG
FDAWAEQSAITRLLSVGAPPDQLNTAGQDWGLAGFNPAGLAANGFAPFRRMLAASMRYAG
AVRLDHVLGLNRIYVVPEGAAPDGGAYIRMPFEAMLASVAIESVSHRCIVIGEDLGTVPD
GFRENLADWAIWSYRVMMFERGADGGFVAPEHYPARALVTFSTHDLATYAGWRQGHDVAL
KEEIGINPGESGRERENAVSALDAALGQAGESGADFSAVLSTLACTPSRLLGVAIEDLLG
VVDQANVPGTMHEHPNWRRKLPVPIEAWDRAIDKDAIQRALELRIVSHEPA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaaaatgatcttgtcgcaaggctgtcacacctcccggcatggcgcgtgtgtgat
gcgaatggcgacgtactcgcctctgagatggatggcgtctcgggtgaaagcgaccttccc
ttcggcgtctatcgtctgcaagacagcgacgctggcgagcgatcgctgattattgcgccc
gagcacgcttatgaaggtgcgttcgatcgccgatggattctgtcggtgcagctctacggc
gtgcgctcggagcgcaactggggcatcggcgatttttccgatctgcaaacgctgctgcgt
tggtccgcgacgtgtggcgcggcgggagttggcctcaatccgttgcatgcgttgtttgac
gatgaaggcgacgattgcagtccgtatgcgccgaacagtcgcctgttcctgaattcgatc
tacatcgacgtcgcggcgctgccggaattgccggagaattttgcgaccgagcatgcggca
gagatcgagcggctgcggaatgccgagttcgtcgattatgccggcgtcgcggcgctaaag
cagcgtgcgctgaggctcgcgttcgcgcagttcaacaaatggacgacgctgaagcgccgc
gcggcgttcgatgcgtttcgcgagcgcggtggcgcgacgctggcgcggtttgcctccttc
gaagcgctgcggcggaaatacaagatcgcctggtgggattggcctgagccatggcgcgcg
ccggatgacgatgcgttggcagatctgcgccgtggcgaagatgcggatgctgttgcgttt
gccgaattcgtgcagtggtgcgcgcacgagcaattgcaggcgtgtgtcgatcttgcccgc
gcgctcgatctgccggtcgggctttatctcgatatcgccgtcggcgtgagagccggcggg
ttcgacgcgtgggccgagcagagcgcgatcacccgcctcctctcggtcggtgcgccgccg
gaccagctcaacaccgcggggcaggattgggggctcgccggcttcaacccggcagggctt
gccgcgaatggctttgcgccgtttcggaggatgctggcggcgtcgatgcgctatgccggc
gcggtgcggctcgatcatgtgctggggctgaaccggatctatgtcgttccggaaggtgcc
gcgccggatggtggcgcctacatccgcatgccgttcgaggcaatgcttgcgagtgtcgcg
atcgagagcgtcagccatcgctgcatcgtcatcggtgaggacctcgggacggtgccggat
ggctttcgcgaaaatctcgccgattgggcgatctggtcctatcgggtgatgatgttcgag
cgtggtgcggatggcgggttcgtcgcgcccgagcattatcccgcgcgagcgctcgtcacc
ttcagcacgcatgatctcgcaacctatgcgggctggcggcaggggcacgacgtcgcgctg
aaggaagagattggcatcaatccgggcgagagcgggcgggagcgggagaatgccgtctcc
gcgctcgacgccgcgcttgggcaggcaggagagtccggtgccgatttcagcgcggtgctg
agcactcttgcttgcacgccgtcgcgtttgttgggcgtcgcgatcgaggatcttctcggc
gtcgtcgatcaggccaatgtgccgggcacgatgcatgagcacccgaactggcggcgcaag
ctgccggtaccgatcgaggcgtgggatcgcgccatagataaagacgccatccagcgtgct
ctggaattgcggattgtatcgcacgaaccggcctga

DBGET integrated database retrieval system